Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G10720 114 / 5e-31 CKI2, AHK5 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1) AT1G27320 51 / 8e-09 AHK3 histidine kinase 3 (.1) AT5G26594 45 / 6e-07 ARR24 response regulator 24 (.1) AT2G01830 44 / 2e-06 CRE1, AHK4, WOL1, WOL, ATCRE1 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3) AT5G35750 43 / 9e-06 AHK2 histidine kinase 2 (.1) AT2G17820 39 / 0.0001 AHK1, ATHK1 histidine kinase 1 (.1) AT2G47430 37 / 0.0006 CKI1 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000105 [exp] 195 / 9e-67 AT5G10720 114 / 7e-31 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1) Lus10020114 [exp] 191 / 9e-65 AT5G10720 177 / 2e-52 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1) Lus10026917 [exp] 199 / 1e-60 AT5G10720 1063 / 0.0 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1) Lus10041891 [exp] 50 / 3e-08 AT2G17820 1561 / 0.0 histidine kinase 1 (.1) Lus10006370 [exp] 49 / 9e-08 AT5G35750 1267 / 0.0 histidine kinase 2 (.1) Lus10015773 [exp] 48 / 1e-07 AT1G27320 1395 / 0.0 histidine kinase 3 (.1) Lus10012325 [exp] 47 / 2e-07 AT5G35750 1278 / 0.0 histidine kinase 2 (.1) Lus10037032 [exp] 47 / 2e-07 AT1G27320 1094 / 0.0 histidine kinase 3 (.1) Lus10028438 [exp] 47 / 2e-07 AT2G17820 1553 / 0.0 histidine kinase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G270500 [exp] 123 / 3e-34 AT5G10720 725 / 0.0 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1) Potri.018G011400 [exp] 122 / 1e-33 AT5G10720 707 / 0.0 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1) Potri.003G171000 [exp] 56 / 3e-10 AT1G27320 1425 / 0.0 histidine kinase 3 (.1) Potri.010G102900 [exp] 51 / 8e-09 AT2G01830 1381 / 0.0 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3) Potri.008G137900 [exp] 50 / 2e-08 AT2G01830 1390 / 0.0 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3) Potri.014G121500 [exp] 48 / 1e-07 AT2G47430 753 / 0.0 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Potri.013G009700 [exp] 48 / 2e-07 AT2G47430 572 / 0.0 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Potri.008G191100 [exp] 47 / 2e-07 AT2G47430 746 / 0.0 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Potri.001G057400 [exp] 46 / 6e-07 AT1G27320 1384 / 0.0 histidine kinase 3 (.1) Potri.007G056400 [exp] 45 / 1e-06 AT2G17820 1475 / 0.0 histidine kinase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0304 [flax] [poplar] CheY PF00072 [flax] [poplar] Response_reg Response regulator receiver domain
Representative CDS sequence Show only first row Show all	>Lus10000137 pacid=23141620 polypeptide=Lus10000137 locus=Lus10000137.g ID=Lus10000137.BGIv1.0 annot-version=v1.0 ATGGTAGCTCGATCCATGATGAAGCAGTTAGGGCACGACATAATTGTGGTGAACAATGGAGTCGAAGCAGTGAAGGCAATACAACGGGAACACTATGATC TCGTTCTAATGGATGTATATATGCCAGTTATGGATGGCCTTCAAGCTACAAGGATAATCCGTTCCTACGAGGAAACAGGAAGGTGGGATGCAGCTGTCCA AGCTGGAATTGAGCAATCAGCCACTTGCTTACAAAATGGGCATAGCTTCCATCCCAGTTCCAGAGATCGTATCCCCATAGTCGCGGTAAGTTAG
AA sequence Show only first row Show all	>Lus10000137 pacid=23141620 polypeptide=Lus10000137 locus=Lus10000137.g ID=Lus10000137.BGIv1.0 annot-version=v1.0 MVARSMMKQLGHDIIVVNNGVEAVKAIQREHYDLVLMDVYMPVMDGLQATRIIRSYEETGRWDAAVQAGIEQSATCLQNGHSFHPSSRDRIPIVAVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G10720		CKI2, AHK5	CYTOKININ INDEPENDENT 2, histi...		Lus10000137 [exp]	0	1
AT5G45580	GARP		Homeodomain-like superfamily p...		Lus10012142 [exp]	3.3	0.9090
AT5G10720		CKI2, AHK5	CYTOKININ INDEPENDENT 2, histi...		Lus10020115 [exp]	10.5	0.9087
					Lus10024121 [exp]	15.7	0.8981
AT1G20190		ATHEXPALPHA1.14...	EXPANSIN 11, expansin 11 (.1)		Lus10034548 [exp]	17.2	0.9046
AT4G23740			Leucine-rich repeat protein ki...		Lus10027568 [exp]	23.2	0.9017
					Lus10005247 [exp]	24.1	0.8865
AT2G30130	AS2	PCK1, LBD12, AS...	PEACOCK 1, Lateral organ bound...		Lus10031855 [exp]	25.0	0.8914
AT1G31690			Copper amine oxidase family pr...		Lus10026757 [exp]	30.3	0.8986
AT5G20110			Dynein light chain type 1 fami...		Lus10014484 [exp]	31.9	0.8881
AT5G14020			Endosomal targeting BRO1-like ...		Lus10012563 [exp]	32.6	0.8788

Compare expression of checked genes

Lus10000137 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.