Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G40660 85 / 3e-21 ATP12 protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024202 [exp] 139 / 5e-42 AT5G40660 351 / 2e-121 ATP12 protein-related (.1) Lus10009910 [exp] 101 / 2e-27 AT5G40660 421 / 2e-148 ATP12 protein-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G338200 [exp] 82 / 3e-20 AT5G40660 303 / 4e-102 ATP12 protein-related (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000142 pacid=23173576 polypeptide=Lus10000142 locus=Lus10000142.g ID=Lus10000142.BGIv1.0 annot-version=v1.0 ATGGAAAACCTTCTCAAAGCTACAACTGATTGTGAACTGGCAGCACTGGATGCGCTTGCATCTGCAGCACATTCATTAGTAAGCGGTGCTGGGATATTCT GCGGGAAATTGGACATTGACGAAGCAATTGAGCTGATTAGACTCGAAGAAGATGTGCAGGTTGACAAATGGGGTTTAGTTGAAGGAGGACATGATTTGGA CATTGCTGATCTGAAGAAGCCAGCTGCTATCTATGATTACATTGATGTAATAATTCCCGAGCAGTAG
AA sequence Show only first row Show all	>Lus10000142 pacid=23173576 polypeptide=Lus10000142 locus=Lus10000142.g ID=Lus10000142.BGIv1.0 annot-version=v1.0 MENLLKATTDCELAALDALASAAHSLVSGAGIFCGKLDIDEAIELIRLEEDVQVDKWGLVEGGHDLDIADLKKPAAIYDYIDVIIPEQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G40660			ATP12 protein-related (.1)		Lus10000142 [exp]	0	1
AT5G40660			ATP12 protein-related (.1)		Lus10024202 [exp]	2.4	0.8662
AT3G57000			nucleolar essential protein-re...		Lus10032053 [exp]	3.0	0.8673
AT1G01150			Homeodomain-like protein with ...		Lus10042361 [exp]	5.1	0.8263
AT2G45520			unknown protein		Lus10009304 [exp]	5.2	0.8311
AT3G55850		LAF3 ISF2, LAF3...	LAF3 ISOFORM 2, LONG AFTER FAR...		Lus10002745 [exp]	5.7	0.8302
AT5G45600		TAF14b, GAS41	TBP-ASSOCIATED FACTOR 14B, GLI...		Lus10007555 [exp]	7.5	0.8476
AT5G08010			unknown protein		Lus10040520 [exp]	7.7	0.8512
AT1G78010			tRNA modification GTPase, puta...		Lus10029578 [exp]	7.9	0.8331
AT5G55700		BAM4, BMY6	BETA-AMYLASE 6, beta-amylase 4...		Lus10022516 [exp]	8.9	0.8225
AT2G13600			Pentatricopeptide repeat (PPR)...		Lus10000213 [exp]	9.5	0.8310

Compare expression of checked genes

Lus10000142 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.