Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G28310 121 / 1e-34 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3) AT1G08040 119 / 7e-34 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) AT3G27470 119 / 1e-33 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) AT1G67850 116 / 2e-32 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) AT1G24570 114 / 7e-32 Protein of unknown function (DUF707) (.1) AT3G26440 110 / 1e-30 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3), Protein of unknown function (DUF707) (.4) AT1G13000 111 / 2e-30 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) AT4G12840 69 / 5e-15 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) AT4G18530 63 / 5e-13 Protein of unknown function (DUF707) (.1) AT1G61240 61 / 3e-12 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3), Protein of unknown function (DUF707) (.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016095 [exp] 180 / 7e-57 AT2G28310 604 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3) Lus10021463 [exp] 180 / 7e-57 AT2G28310 594 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3) Lus10041316 [exp] 156 / 2e-47 AT2G28310 590 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3) Lus10037396 [exp] 154 / 4e-45 AT5G60700 1181 / 0.0 glycosyltransferase family protein 2 (.1) Lus10003659 [exp] 111 / 1e-30 AT3G27470 563 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Lus10011414 [exp] 110 / 3e-30 AT1G67850 611 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Lus10006472 [exp] 109 / 6e-30 AT1G67850 598 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Lus10032090 [exp] 108 / 2e-29 AT3G27470 564 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Lus10035229 [exp] 105 / 7e-29 AT1G67850 452 / 1e-159 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G011000 [exp] 120 / 4e-34 AT2G28310 608 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3) Potri.008G185600 [exp] 117 / 8e-33 AT1G67850 610 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Potri.010G047200 [exp] 115 / 3e-32 AT1G67850 581 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Potri.017G065200 [exp] 112 / 7e-31 AT3G27470 605 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Potri.014G175800 [exp] 71 / 9e-16 AT4G12840 482 / 1e-170 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Potri.019G053000 [exp] 66 / 6e-14 AT4G18530 444 / 4e-156 Protein of unknown function (DUF707) (.1) Potri.004G036800 [exp] 64 / 2e-13 AT1G61240 535 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3), Protein of unknown function (DUF707) (.4) Potri.011G045300 [exp] 64 / 3e-13 AT1G61240 534 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3), Protein of unknown function (DUF707) (.4) Potri.003G003100 [exp] 63 / 5e-13 AT4G18530 480 / 4e-170 Protein of unknown function (DUF707) (.1) Potri.004G227700 [exp] 61 / 3e-12 AT4G18530 466 / 1e-164 Protein of unknown function (DUF707) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05212 [flax] [poplar] DUF707 Protein of unknown function (DUF707)
Representative CDS sequence Show only first row Show all	>Lus10000145 pacid=23177883 polypeptide=Lus10000145 locus=Lus10000145.g ID=Lus10000145.BGIv1.0 annot-version=v1.0 ATGGCCCCTGTATTTTCTCAGAAGGCTTGGCGATGCGTGTGGCATATGATTCAGAATGATTTGGTGCACGGATGGGGATTGGATTTCGCTCTCAGAAGAT GCGTAGAGGGACAATCTGAAAATGGAAAAGCACCATGGGAAGGGGTGAGAGCAAGGTGCAAGAGCGAATGGTCCATGTTCCAGGAGCGCCTCCTTCGCGC AGACAAAGCCTACTTCTCGAGCCGCGCTGGCAGTGCCGATAACAAGGAGTACTTGGCTCGACTCAAGGGTATCGGAAACTGA
AA sequence Show only first row Show all	>Lus10000145 pacid=23177883 polypeptide=Lus10000145 locus=Lus10000145.g ID=Lus10000145.BGIv1.0 annot-version=v1.0 MAPVFSQKAWRCVWHMIQNDLVHGWGLDFALRRCVEGQSENGKAPWEGVRARCKSEWSMFQERLLRADKAYFSSRAGSADNKEYLARLKGIGN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G28310			Protein of unknown function (D...		Lus10000145 [exp]	0	1
AT3G53970			proteasome inhibitor-related (...		Lus10035223 [exp]	2.4	0.7243
AT5G54855			Pollen Ole e 1 allergen and ex...		Lus10019622 [exp]	2.8	0.7441
AT2G28310			Protein of unknown function (D...		Lus10021463 [exp]	3.3	0.6578
AT5G43490			unknown protein		Lus10003153 [exp]	9.3	0.7242
AT5G37930			Protein with RING/U-box and TR...		Lus10028535 [exp]	17.0	0.7025
AT5G10870		ATCM2	chorismate mutase 2 (.1)		Lus10007444 [exp]	18.3	0.6984
					Lus10031351 [exp]	20.1	0.7240
AT5G19260		FAF3	FANTASTIC FOUR 3, Protein of u...		Lus10041217 [exp]	24.5	0.5732
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Lus10043184 [exp]	29.4	0.6879
AT5G67320		HOS15	high expression of osmotically...		Lus10024972 [exp]	33.0	0.6816

Compare expression of checked genes

Lus10000145 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.