Lus10000149 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G41390 66 / 1e-13 PLAC8 family protein (.1.2)
AT4G23470 62 / 1e-12 PLAC8 family protein (.1.2.3)
AT1G63830 62 / 3e-12 PLAC8 family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036377 120 / 1e-32 AT3G09740 347 / 8e-117 syntaxin of plants 71 (.1)
Lus10018826 111 / 1e-30 AT4G23470 328 / 2e-113 PLAC8 family protein (.1.2.3)
Lus10014759 96 / 1e-23 AT3G09740 308 / 4e-102 syntaxin of plants 71 (.1)
Lus10017509 65 / 3e-13 AT1G63830 379 / 1e-134 PLAC8 family protein (.1.2.3)
Lus10028774 56 / 5e-10 AT1G63830 350 / 1e-122 PLAC8 family protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G087600 77 / 8e-18 AT5G41390 327 / 8e-114 PLAC8 family protein (.1.2)
Potri.003G130700 65 / 3e-13 AT1G63830 341 / 1e-119 PLAC8 family protein (.1.2.3)
Potri.001G101100 62 / 2e-12 AT1G63830 353 / 2e-124 PLAC8 family protein (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10000149 pacid=23180231 polypeptide=Lus10000149 locus=Lus10000149.g ID=Lus10000149.BGIv1.0 annot-version=v1.0
ATGAATTATTCCTCCGAGAAGGCGGCGCAAATGCATTTGCGCCAGAACTACAGGAATCTCTGGCGCACCGATCTCCCTGTACTCGACCATGCGCTTCCTA
CATTCTGCGCAAGCGAGCTCTTTATAATCACTTGTCAAGGTACACTTGCGGTGCTGGCTACATGCCTTGCAGTGGCATATGCGGAGAAAGCAATTGCCCT
CAATTTTGTCTTTGCACCGAGTCCTGGTGTTGCTTCGCTAATTCGGTTGCCTCAACACGCTTCCAGACTTCACCCTGGGTTCATGCTGTGCCTGCAGCAG
TTGGCCTGTATCTGCTCCTGTGTTGCATGCATAACTGGAATCGACGAAGTAGGAGAGATTCCTCACCTCTTGACTTGCTTGTCTGATATCGTCTATTGCT
CGAAAGAATGGTCCTAA
AA sequence
>Lus10000149 pacid=23180231 polypeptide=Lus10000149 locus=Lus10000149.g ID=Lus10000149.BGIv1.0 annot-version=v1.0
MNYSSEKAAQMHLRQNYRNLWRTDLPVLDHALPTFCASELFIITCQGTLAVLATCLAVAYAEKAIALNFVFAPSPGVASLIRLPQHASRLHPGFMLCLQQ
LACICSCVACITGIDEVGEIPHLLTCLSDIVYCSKEWS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G41390 PLAC8 family protein (.1.2) Lus10000149 0 1
AT1G63060 unknown protein Lus10000001 12.2
AT5G26150 protein kinase family protein ... Lus10000068 100.3
AT5G35110 unknown protein Lus10000078 107.4
AT2G38540 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRA... Lus10000082 110.2
AT2G46490 unknown protein Lus10000088 114.1
AT4G09160 SEC14 cytosolic factor family ... Lus10000102 122.9
AT1G60780 HAP13 HAPLESS 13, Clathrin adaptor c... Lus10000107 125.8
Lus10000109 127.0
AT3G07565 Protein of unknown function (D... Lus10000123 134.9
Lus10000134 140.8

Lus10000149 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.