Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G52980 149 / 2e-46 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019043 [exp] 204 / 6e-68 AT5G52980 238 / 4e-80 unknown protein Lus10005024 [exp] 201 / 6e-67 AT5G52980 236 / 3e-79 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G093800 [exp] 157 / 8e-50 AT5G52980 223 / 6e-74 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11712 [flax] [poplar] Vma12 Endoplasmic reticulum-based factor for assembly of V-ATPase
Representative CDS sequence Show only first row Show all	>Lus10000151 pacid=23172391 polypeptide=Lus10000151 locus=Lus10000151.g ID=Lus10000151.BGIv1.0 annot-version=v1.0 ATGGTTGGTGAGGTATTGGTTGATCAGAGTGAAGAACTGAAGGCAAGGTTGAGGAAACTTGAGGAGTTAGCGGAGAGAAAGGCCTATCAGGAACTAGTCA AGGATATTACCCCAAGAAAAGATACGAATGAACCCTTCTCTTCTTACAAGGATCAGCTTGGTTTTGGTCTGCATGTTGGTCTGACCATGTTCACTGGATA TTTAGTTGGATATGCAGCATTCAGAGCATTGTTCGGGCGCACTCCTGCCATGAGCGCTGCTGGAGGAATTCTGGGACTTGTCTTTGGGATGCTTGTGGAA ACCCTTCTTTTCATAATTAGAACATCTAGTGATCAAGCTCCCAAACAATACAAATCCACATCCAAGGTAAAGAAGCAGTAG
AA sequence Show only first row Show all	>Lus10000151 pacid=23172391 polypeptide=Lus10000151 locus=Lus10000151.g ID=Lus10000151.BGIv1.0 annot-version=v1.0 MVGEVLVDQSEELKARLRKLEELAERKAYQELVKDITPRKDTNEPFSSYKDQLGFGLHVGLTMFTGYLVGYAAFRALFGRTPAMSAAGGILGLVFGMLVE TLLFIIRTSSDQAPKQYKSTSKVKKQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G52980			unknown protein		Lus10000151 [exp]	0	1
AT5G32440			Ubiquitin system component Cue...		Lus10027699 [exp]	8.7	0.7126
AT5G52880			F-box family protein (.1)		Lus10027547 [exp]	9.2	0.7565
AT1G16250			Galactose oxidase/kelch repeat...		Lus10013899 [exp]	9.8	0.7578
AT4G03965			RING/U-box superfamily protein...		Lus10029993 [exp]	10.2	0.7676
AT3G58090			Disease resistance-responsive ...		Lus10009074 [exp]	11.0	0.7573
AT1G35430			unknown protein		Lus10001289 [exp]	11.8	0.7447
AT5G51280			DEAD-box protein abstrakt, put...		Lus10008856 [exp]	12.0	0.7160
AT1G04760		ATVAMP726	vesicle-associated membrane pr...		Lus10018296 [exp]	20.3	0.7561
AT1G67970	HSF	AT-HSFA8	heat shock transcription facto...		Lus10001591 [exp]	21.2	0.7331
					Lus10012006 [exp]	21.5	0.7253

Compare expression of checked genes

Lus10000151 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.