Lus10000153 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G36930 132 / 4e-35 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
AT1G72890 126 / 5e-34 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2)
AT1G27180 125 / 1e-32 disease resistance protein (TIR-NBS-LRR class), putative (.1)
AT1G72950 118 / 3e-31 Disease resistance protein (TIR-NBS class) (.1)
AT1G72930 112 / 4e-31 TIR toll/interleukin-1 receptor-like (.1.2)
AT1G27170 119 / 2e-30 transmembrane receptors;ATP binding (.1.2)
AT1G72910 115 / 4e-30 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1)
AT1G17615 114 / 1e-29 Disease resistance protein (TIR-NBS class) (.1)
AT1G72900 112 / 5e-29 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1)
AT1G72920 109 / 7e-29 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002247 387 / 3e-129 AT5G36930 363 / 1e-108 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10002249 375 / 2e-123 AT5G36930 286 / 2e-80 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10008519 332 / 4e-105 AT1G27180 344 / 2e-98 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10004719 323 / 1e-102 AT5G36930 384 / 3e-113 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10004727 271 / 2e-90 AT1G27180 182 / 2e-53 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10008526 287 / 6e-90 AT5G36930 361 / 5e-106 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10000331 280 / 9e-88 AT5G36930 217 / 1e-57 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10007790 280 / 3e-87 AT5G36930 343 / 4e-99 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10007811 245 / 2e-74 AT5G36930 376 / 1e-110 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.T002568 165 / 4e-48 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G019710 164 / 2e-47 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.T002200 166 / 7e-47 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.007G143100 157 / 7e-47 AT5G36930 234 / 1e-69 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G046000 162 / 2e-46 AT5G36930 496 / 1e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.T002400 163 / 4e-46 AT5G36930 658 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G021681 162 / 1e-45 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.T001500 162 / 1e-45 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G017082 160 / 5e-45 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.T002428 157 / 5e-45 AT5G36930 387 / 2e-122 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0173 STIR PF01582 TIR TIR domain
Representative CDS sequence
>Lus10000153 pacid=23149884 polypeptide=Lus10000153 locus=Lus10000153.g ID=Lus10000153.BGIv1.0 annot-version=v1.0
ATGAGTTATTTGAGAGATGTTGCTACTGTGCTTGCCTTGCTTCTCCCACTCATTCTTCTCTACAAGTTTTGGAGACTAAATTCCAAACACTCAATCGTCA
ACGATGACGACGATTCAACATCTGAAGTTGATACCATACCCGACTCCACAAATCCCTCTGGCTCGTTTCCCTCCGTGGAGTATGAGGTGTTTTTGAGTTT
CAGGGGTCCAGATACTCGTTATCAAATCACCGACATCCTCTATCGTTTTCTTTGTCGCACAAAGATTCACACGTTTAGAGACGATGATGAGCTTCGTAAG
GGAGAAGAGATAAAGGCCACCCTCCTCAGAGCAATCAACCAGTCGAAAATTTATGTCCCGATCATATCACGAGGTTACGCCGATAGTAAATGGTGTCTTA
TGGAGCTTGCTGAAATCGTTCGACATCAAAAGCTGGACACTCGACGGATTATACTTCCTATTTTTTATATGGTGAATCCAAAAGATGTGCGACATCAGAC
TGGACCTTATCGAAAGGCATTTCAAGAACACACGACTAAATATGATGCAATCACCATACAGAACTGGAAAGATGCTCTGAATAAGGTTGGAACTTTAAAA
GGATGGCACGTCAAAAACAATGACGAGTACGTAATCCTCACCCTCAGCCTTTTATTATTCACTATCGTATATACTTGCTTATTGACTAAGTTTCACAATT
GA
AA sequence
>Lus10000153 pacid=23149884 polypeptide=Lus10000153 locus=Lus10000153.g ID=Lus10000153.BGIv1.0 annot-version=v1.0
MSYLRDVATVLALLLPLILLYKFWRLNSKHSIVNDDDDSTSEVDTIPDSTNPSGSFPSVEYEVFLSFRGPDTRYQITDILYRFLCRTKIHTFRDDDELRK
GEEIKATLLRAINQSKIYVPIISRGYADSKWCLMELAEIVRHQKLDTRRIILPIFYMVNPKDVRHQTGPYRKAFQEHTTKYDAITIQNWKDALNKVGTLK
GWHVKNNDEYVILTLSLLLFTIVYTCLLTKFHN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G36930 Disease resistance protein (TI... Lus10000153 0 1
AT5G36930 Disease resistance protein (TI... Lus10002247 1.0 0.9710
AT5G14420 RGLG2 RING domain ligase2 (.1.2.3.4) Lus10011405 7.3 0.8947
AT1G48410 AGO1 ARGONAUTE 1, Stabilizer of iro... Lus10023882 13.6 0.8506
AT5G58880 unknown protein Lus10005869 16.6 0.8630
Lus10007776 18.0 0.8606
AT5G65030 unknown protein Lus10026048 19.7 0.8908
AT2G29350 SAG13 senescence-associated gene 13 ... Lus10024358 22.4 0.8821
AT1G67940 ABCI17, AtSTAR1... ARABIDOPSIS THALIANA NON-INTRI... Lus10035453 25.0 0.8541
AT2G28080 UDP-Glycosyltransferase superf... Lus10016126 29.1 0.8663
AT5G23750 Remorin family protein (.1.2) Lus10001477 35.1 0.8770

Lus10000153 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.