Lus10000155 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64630 147 / 7e-43 MUB3.9, NFB1, NFB01, MUB3, FAS2 FASCIATA 2, Transducin/WD40 repeat-like superfamily protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033489 299 / 2e-101 AT5G64630 612 / 0.0 FASCIATA 2, Transducin/WD40 repeat-like superfamily protein (.1.2.3)
Lus10020888 148 / 8e-42 AT5G64630 563 / 0.0 FASCIATA 2, Transducin/WD40 repeat-like superfamily protein (.1.2.3)
Lus10020585 40 / 0.0003 AT3G44530 1395 / 0.0 homolog of histone chaperone HIRA (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G108200 174 / 5e-53 AT5G64630 667 / 0.0 FASCIATA 2, Transducin/WD40 repeat-like superfamily protein (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10000155 pacid=23181305 polypeptide=Lus10000155 locus=Lus10000155.g ID=Lus10000155.BGIv1.0 annot-version=v1.0
ATGATGACCAAAAAGGCTGATTATCCAATCTTGAACTATGCAGATGGGCTCTTCAAACTTCCTTACCGCCTGATTTTCGCGGTAGCTACTCTAAATTCGG
TGTACATATACGATACCGAAAGTGTTCCTCCGATAGCAGTTCTTGCGGGGCTTCACTATGCTGCAATCACAGACATTGCATGGTCAGCTAATGGAGAGCT
CTTAGCAGTGTCGTCTCAAGACGGCTACTGCACCTTAGTCGAATTCCAAAGCAACGAACTGGGTTCGCCTCTTGTCGCTCAAGGTTGGGGAACGAAGAAC
AGCATGCCTCAGAGTGATAAGAAACCCGAGGAAGACGGAGAAGCAATGGACATCAGTGGCGGTTCTTCTACAAACGCAGAAGGTAAAAAGATCAGTGTGG
AAGAGAAGAGTACATCTCCAGTTGCGGTGTCTGCAACTCCTGCGAATCCTAACAAGCCAGCAAGGAAGAGAATTACTCCTATGGCGATTGATCCGTAG
AA sequence
>Lus10000155 pacid=23181305 polypeptide=Lus10000155 locus=Lus10000155.g ID=Lus10000155.BGIv1.0 annot-version=v1.0
MMTKKADYPILNYADGLFKLPYRLIFAVATLNSVYIYDTESVPPIAVLAGLHYAAITDIAWSANGELLAVSSQDGYCTLVEFQSNELGSPLVAQGWGTKN
SMPQSDKKPEEDGEAMDISGGSSTNAEGKKISVEEKSTSPVAVSATPANPNKPARKRITPMAIDP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G64630 MUB3.9, NFB1, N... FASCIATA 2, Transducin/WD40 re... Lus10000155 0 1
AT5G08020 ATRPA70B ARABIDOPSIS THALIANA RPA70-KDA... Lus10003268 6.7 0.8451
AT2G45280 ATRAD51C RAS associated with diabetes p... Lus10030284 21.6 0.7264
AT5G64630 MUB3.9, NFB1, N... FASCIATA 2, Transducin/WD40 re... Lus10033489 22.3 0.8071
AT3G54560 HTA11 histone H2A 11 (.1) Lus10024838 25.7 0.8003
AT2G45280 ATRAD51C RAS associated with diabetes p... Lus10000790 27.6 0.7522
AT4G10650 P-loop containing nucleoside t... Lus10014654 34.2 0.6642
AT1G20720 RAD3-like DNA-binding helicase... Lus10016027 35.7 0.7818
AT4G15620 Uncharacterised protein family... Lus10031998 35.8 0.7566
AT5G54010 UDP-Glycosyltransferase superf... Lus10003154 39.0 0.6941
Lus10030985 40.2 0.7105

Lus10000155 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.