Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05345 102 / 8e-28 Chaperone DnaJ-domain superfamily protein (.1) AT2G22360 56 / 3e-10 DNAJ heat shock family protein (.1) AT4G39960 53 / 4e-09 Molecular chaperone Hsp40/DnaJ family protein (.1) AT5G23240 49 / 9e-08 DNAJ heat shock N-terminal domain-containing protein (.1) AT1G80030 49 / 1e-07 Molecular chaperone Hsp40/DnaJ family protein (.1.2.3) AT3G08970 46 / 1e-06 TMS1, ATERDJ3A THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) AT3G17830 45 / 3e-06 Molecular chaperone Hsp40/DnaJ family protein (.1) AT4G21180 44 / 5e-06 ATERDJ2B DnaJ / Sec63 Brl domains-containing protein (.1) AT1G79940 44 / 7e-06 ATERDJ2A DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4) AT1G72070 42 / 7e-06 Chaperone DnaJ-domain superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029916 [exp] 237 / 8e-81 AT3G05345 277 / 2e-94 Chaperone DnaJ-domain superfamily protein (.1) Lus10004485 [exp] 219 / 2e-73 AT3G05345 287 / 2e-98 Chaperone DnaJ-domain superfamily protein (.1) Lus10029928 [exp] 110 / 2e-31 AT3G05345 205 / 1e-66 Chaperone DnaJ-domain superfamily protein (.1) Lus10023148 [exp] 50 / 3e-08 AT2G22360 675 / 0.0 DNAJ heat shock family protein (.1) Lus10000631 [exp] 50 / 7e-08 AT2G22360 672 / 0.0 DNAJ heat shock family protein (.1) Lus10011536 [exp] 48 / 3e-07 AT4G37480 484 / 5e-168 Chaperone DnaJ-domain superfamily protein (.1) Lus10019286 [exp] 48 / 3e-07 AT4G37480 526 / 0.0 Chaperone DnaJ-domain superfamily protein (.1) Lus10003380 [exp] 46 / 1e-06 AT3G08970 615 / 0.0 THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) Lus10011484 [exp] 45 / 2e-06 AT1G80030 638 / 0.0 Molecular chaperone Hsp40/DnaJ family protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G021000 [exp] 86 / 1e-21 AT3G05345 288 / 1e-98 Chaperone DnaJ-domain superfamily protein (.1) Potri.003G031800 [exp] 50 / 3e-08 AT1G80030 607 / 0.0 Molecular chaperone Hsp40/DnaJ family protein (.1.2.3) Potri.005G073900 [exp] 48 / 2e-07 AT2G22360 659 / 0.0 DNAJ heat shock family protein (.1) Potri.016G120000 [exp] 48 / 2e-07 AT3G08970 479 / 6e-164 THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) Potri.007G094900 [exp] 47 / 6e-07 AT2G22360 688 / 0.0 DNAJ heat shock family protein (.1) Potri.002G020800 [exp] 45 / 8e-07 AT2G17880 110 / 3e-31 Chaperone DnaJ-domain superfamily protein (.1) Potri.013G058100 [exp] 45 / 3e-06 AT5G18140 264 / 1e-86 Chaperone DnaJ-domain superfamily protein (.1) Potri.001G347600 [exp] 45 / 3e-06 AT5G23240 149 / 2e-41 DNAJ heat shock N-terminal domain-containing protein (.1) Potri.002G114600 [exp] 44 / 3e-06 AT4G07990 216 / 3e-71 Chaperone DnaJ-domain superfamily protein (.1.2) Potri.003G183700 [exp] 44 / 5e-06 AT1G80920 130 / 4e-39 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [flax] [poplar] Chaperone-J PF00226 [flax] [poplar] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Lus10000158 pacid=23163520 polypeptide=Lus10000158 locus=Lus10000158.g ID=Lus10000158.BGIv1.0 annot-version=v1.0 ATGGCGACCTTAGCTTTCTGCCATTCTTCTGTGCCACCGATTCTTCCTCCACTTCACAGTACCAATTTCTCGAATCCAACTCCCGGAAACACGATTCGAT TTATTCGGAGCTCCAAATTCGCACTCCGTTGCACTTCGGGCGATGGTTCTTCTTCTTCGCCCCATGCCGTTCTCGGCGTCGATCCGGGATGCTCAGCCGC CGAGCTCAAAGCCGCGTTCCGAGCGAAAGTGAAGCAGTTCCATCCCGACGTCATTGGAGACAAAGGATCCGATGTCATGATTCGCCGCGTGATTCGAGCG TATGAGATCTTATCCGATTATACCCGGTCAGAGATCATCGAAAGGTGA
AA sequence Show only first row Show all	>Lus10000158 pacid=23163520 polypeptide=Lus10000158 locus=Lus10000158.g ID=Lus10000158.BGIv1.0 annot-version=v1.0 MATLAFCHSSVPPILPPLHSTNFSNPTPGNTIRFIRSSKFALRCTSGDGSSSSPHAVLGVDPGCSAAELKAAFRAKVKQFHPDVIGDKGSDVMIRRVIRA YEILSDYTRSEIIER

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G05345			Chaperone DnaJ-domain superfam...		Lus10000158 [exp]	0	1
AT2G25290		Phox1	Phox1, Octicosapeptide/Phox/Be...		Lus10008035 [exp]	2.8	0.8128
AT1G12450			SNARE associated Golgi protein...		Lus10028900 [exp]	8.7	0.7980
AT3G61050		AtCLB, NTMCTYPE...	calcium-dependent lipid-bindin...		Lus10041396 [exp]	10.0	0.7994
AT5G01450			RING/U-box superfamily protein...		Lus10002487 [exp]	10.4	0.8102
AT1G55535			unknown protein		Lus10010333 [exp]	10.4	0.8039
AT5G01990			Auxin efflux carrier family pr...		Lus10035610 [exp]	14.1	0.7814
AT4G26700		ATFIM1	ARABIDOPSIS THALIANA FIMBRIN 1...		Lus10016580 [exp]	17.3	0.7788
AT1G65580		FRA3	FRAGILE FIBER3, Endonuclease/e...		Lus10024112 [exp]	17.5	0.7927
AT4G11800			Calcineurin-like metallo-phosp...		Lus10021750 [exp]	19.0	0.7659
AT4G36860		DAR1	DA1-RELATED PROTEIN 1, LIM dom...		Lus10016791 [exp]	19.9	0.7763

Compare expression of checked genes

Lus10000158 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.