Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G17440 102 / 4e-29 ATNPSN13, NPSN13 novel plant snare 13 (.1.2) AT1G48240 96 / 6e-26 ATNPSN12 novel plant snare 12 (.1) AT2G35190 59 / 4e-12 NSPN11, ATNPSN11, NPSN11 novel plant snare 11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017116 [exp] 129 / 9e-39 AT3G17440 410 / 6e-146 novel plant snare 13 (.1.2) Lus10018338 [exp] 124 / 3e-36 AT3G17440 375 / 2e-131 novel plant snare 13 (.1.2) Lus10003004 [exp] 59 / 4e-12 AT2G35190 366 / 5e-129 novel plant snare 11 (.1) Lus10011034 [exp] 59 / 5e-12 AT2G35190 274 / 2e-93 novel plant snare 11 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G001900 [exp] 102 / 1e-28 AT3G17440 429 / 8e-154 novel plant snare 13 (.1.2) Potri.003G085200 [exp] 67 / 6e-15 AT2G35190 391 / 6e-139 novel plant snare 11 (.1) Potri.001G149200 [exp] 67 / 7e-15 AT2G35190 389 / 4e-138 novel plant snare 11 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000163 pacid=23168457 polypeptide=Lus10000163 locus=Lus10000163.g ID=Lus10000163.BGIv1.0 annot-version=v1.0 ATGGCCACCAACTTGCAGATGGGTTCTAAGATGGAGCAGATCCATGGCGAAATCAACGACAATTTCCGTGCTCTCTCACTGATTAAGGAGTTTGATAGTG AGATTAAAGATGAGGAAGCCAGAAACCCACCTGAGGTCACTAAACAGCTCAATGATGAGAAGCAATCCATGATAAAAGAGCTGAATTCCTATGTTGCATT GAGGAAGACAATGTGA
AA sequence Show only first row Show all	>Lus10000163 pacid=23168457 polypeptide=Lus10000163 locus=Lus10000163.g ID=Lus10000163.BGIv1.0 annot-version=v1.0 MATNLQMGSKMEQIHGEINDNFRALSLIKEFDSEIKDEEARNPPEVTKQLNDEKQSMIKELNSYVALRKTM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G17440		ATNPSN13, NPSN1...	novel plant snare 13 (.1.2)		Lus10000163 [exp]	0	1
AT3G17220		ATPMEI2	pectin methylesterase inhibito...		Lus10017346 [exp]	6.7	0.6958
					Lus10003006 [exp]	20.9	0.7346
AT5G43900		XI-6, XI-2, ATM...	MYOSIN XI-6, MYOSIN X1 2, ARAB...		Lus10032597 [exp]	29.4	0.6916
					Lus10027106 [exp]	91.7	0.6413
AT1G66430			pfkB-like carbohydrate kinase ...		Lus10002101 [exp]	145.0	0.6161

Compare expression of checked genes

Lus10000163 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.