Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G17380 183 / 6e-55 MSH4, ATMSH4 ARABIDOPSIS MUTS HOMOLOG 4, MUTS-like protein 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028966 [exp] 246 / 2e-81 AT4G17380 413 / 3e-137 ARABIDOPSIS MUTS HOMOLOG 4, MUTS-like protein 4 (.1) Lus10007489 [exp] 69 / 2e-14 AT4G17380 1205 / 0.0 ARABIDOPSIS MUTS HOMOLOG 4, MUTS-like protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G156200 [exp] 0 / 1 AT4G17380 1226 / 0.0 ARABIDOPSIS MUTS HOMOLOG 4, MUTS-like protein 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00488 [flax] [poplar] MutS_V MutS domain V
Representative CDS sequence Show only first row Show all	>Lus10000166 pacid=23175418 polypeptide=Lus10000166 locus=Lus10000166.g ID=Lus10000166.BGIv1.0 annot-version=v1.0 ATGGAGAATCTAGCGGAACTTGCAGCACTCTATCCAAATGTGAAGATCCTACACTTCGATGTCGATATACGAAACAACCGCTTGGATTTCAAGTTTCAAC TCAAGGATGGACCAAGACACATTCCCCATTATGGACTTCTATTAGCCCAAGTTGCAGGACTACCGAGCTCAGTTATCAAAACTGCACGAAGCATCACATC ATACATCACACAAAAGGAAACGAATAGAATGGACGAGGACTGCGAGCAGCATCAGCAACTACATATGGTTTATCGGGTAGCCCAAAGGCTGTTATGCTTG AAATTTTCGAGCCAACATGAGGATGCGATTCGACAAGCACTCCAGAATCTCAAGGATAGCTATCTGGACGGATCGCTCTGA
AA sequence Show only first row Show all	>Lus10000166 pacid=23175418 polypeptide=Lus10000166 locus=Lus10000166.g ID=Lus10000166.BGIv1.0 annot-version=v1.0 MENLAELAALYPNVKILHFDVDIRNNRLDFKFQLKDGPRHIPHYGLLLAQVAGLPSSVIKTARSITSYITQKETNRMDEDCEQHQQLHMVYRVAQRLLCL KFSSQHEDAIRQALQNLKDSYLDGSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G17380		MSH4, ATMSH4	ARABIDOPSIS MUTS HOMOLOG 4, M...		Lus10000166 [exp]	0	1
AT1G69010	bHLH	bHLH102, BIM2	BES1-interacting Myc-like prot...		Lus10005091 [exp]	5.7	0.8904
AT4G03500			Ankyrin repeat family protein ...		Lus10026833 [exp]	6.5	0.8332
					Lus10014678 [exp]	8.5	0.8904
AT5G15940			NAD(P)-binding Rossmann-fold s...		Lus10022466 [exp]	11.2	0.8628
AT4G01710		ARPC5, CRK	CROOKED, ARP2/3 complex 16 kDa...		Lus10012040 [exp]	11.8	0.8632
AT1G11330			S-locus lectin protein kinase ...		Lus10015422 [exp]	14.0	0.8644
AT1G76480			unknown protein		Lus10006035 [exp]	15.0	0.8748
AT1G50910			unknown protein		Lus10043058 [exp]	16.6	0.8314
AT3G52120			SWAP (Suppressor-of-White-APri...		Lus10037485 [exp]	19.1	0.8469
AT5G67170			SEC-C motif-containing protein...		Lus10006255 [exp]	21.2	0.8512

Compare expression of checked genes

Lus10000166 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.