Lus10000168 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00900 46 / 4e-08 ATCG00900.1, RPS7.1 CHLOROPLAST RIBOSOMAL PROTEIN S7, Ribosomal protein S7p/S5e family protein (.1)
ATCG01240 46 / 4e-08 ATCG01240.1, RPS7.2 ribosomal protein S7 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002395 119 / 2e-37 ATCG00900 46 / 5e-08 CHLOROPLAST RIBOSOMAL PROTEIN S7, Ribosomal protein S7p/S5e family protein (.1)
Lus10027894 60 / 1e-12 ATCG00900 167 / 7e-53 CHLOROPLAST RIBOSOMAL PROTEIN S7, Ribosomal protein S7p/S5e family protein (.1)
Lus10002394 59 / 2e-12 ATCG00900 229 / 3e-77 CHLOROPLAST RIBOSOMAL PROTEIN S7, Ribosomal protein S7p/S5e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G075200 47 / 5e-09 ATCG00900 81 / 7e-22 CHLOROPLAST RIBOSOMAL PROTEIN S7, Ribosomal protein S7p/S5e family protein (.1)
Potri.013G138900 48 / 9e-09 ATCG00900 310 / 2e-110 CHLOROPLAST RIBOSOMAL PROTEIN S7, Ribosomal protein S7p/S5e family protein (.1)
Potri.004G140500 43 / 1e-06 ATCG00900 249 / 2e-85 CHLOROPLAST RIBOSOMAL PROTEIN S7, Ribosomal protein S7p/S5e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00177 Ribosomal_S7 Ribosomal protein S7p/S5e
Representative CDS sequence
>Lus10000168 pacid=23175830 polypeptide=Lus10000168 locus=Lus10000168.g ID=Lus10000168.BGIv1.0 annot-version=v1.0
ATGATTTGTTGGGCTGATTACAGCTCGAAAGAGGCCGACAAGGTAGGGGATATGGTGTTCAAGCTGAGTAATGAACTGATGGATGCAGCTAAAGGGGGTG
GTCATGTTGTTAGGAAGAAGGACGAAGTGCTTAAGACCGCTGAGGCGAATGAGGGCTGTCGAGCATTGTCGTTGTAA
AA sequence
>Lus10000168 pacid=23175830 polypeptide=Lus10000168 locus=Lus10000168.g ID=Lus10000168.BGIv1.0 annot-version=v1.0
MICWADYSSKEADKVGDMVFKLSNELMDAAKGGGHVVRKKDEVLKTAEANEGCRALSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
ATCG00900 ATCG00900.1, RP... CHLOROPLAST RIBOSOMAL PROTEIN ... Lus10000168 0 1
ATCG00900 ATCG00900.1, RP... CHLOROPLAST RIBOSOMAL PROTEIN ... Lus10002395 1.0 1.0000
AT2G46300 Late embryogenesis abundant (L... Lus10010130 1.7 0.8825
AT3G28470 MYB TDF1, ATMYB35 DEFECTIVE IN MERISTEM DEVELOPM... Lus10005834 6.5 0.9104
Lus10008418 7.1 0.7931
AT3G18180 Glycosyltransferase family 61 ... Lus10032457 7.2 0.7808
Lus10034849 9.6 0.8592
AT3G43660 Vacuolar iron transporter (VIT... Lus10031543 10.4 0.7530
Lus10025316 11.2 0.8372
AT2G40780 Nucleic acid-binding, OB-fold-... Lus10030510 12.2 0.8372
AT3G25820 ATTPS-CIN "terpene synthase-like sequenc... Lus10000476 13.0 0.6575

Lus10000168 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.