Lus10000175 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G24290 261 / 7e-88 MAC/Perforin domain-containing protein (.1.2)
AT1G28380 202 / 2e-62 NSL1 necrotic spotted lesions 1, MAC/Perforin domain-containing protein (.1)
AT1G14780 155 / 8e-45 MAC/Perforin domain-containing protein (.1)
AT1G29690 144 / 8e-41 CAD1 constitutively activated cell death 1, MAC/Perforin domain-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035789 332 / 2e-112 AT4G24290 911 / 0.0 MAC/Perforin domain-containing protein (.1.2)
Lus10037363 263 / 4e-86 AT4G24290 837 / 0.0 MAC/Perforin domain-containing protein (.1.2)
Lus10012717 207 / 2e-64 AT4G24290 764 / 0.0 MAC/Perforin domain-containing protein (.1.2)
Lus10010894 206 / 9e-64 AT4G24290 761 / 0.0 MAC/Perforin domain-containing protein (.1.2)
Lus10015324 185 / 1e-56 AT4G24290 312 / 8e-100 MAC/Perforin domain-containing protein (.1.2)
Lus10025453 177 / 7e-53 AT1G28380 745 / 0.0 necrotic spotted lesions 1, MAC/Perforin domain-containing protein (.1)
Lus10021803 144 / 5e-41 AT1G28380 377 / 9e-125 necrotic spotted lesions 1, MAC/Perforin domain-containing protein (.1)
Lus10037426 140 / 3e-39 AT1G14780 514 / 2e-176 MAC/Perforin domain-containing protein (.1)
Lus10034586 140 / 4e-39 AT1G14780 567 / 0.0 MAC/Perforin domain-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G006500 301 / 1e-100 AT4G24290 922 / 0.0 MAC/Perforin domain-containing protein (.1.2)
Potri.019G001000 239 / 7e-77 AT4G24290 780 / 0.0 MAC/Perforin domain-containing protein (.1.2)
Potri.001G305600 228 / 2e-72 AT4G24290 783 / 0.0 MAC/Perforin domain-containing protein (.1.2)
Potri.011G057100 207 / 3e-64 AT1G28380 790 / 0.0 necrotic spotted lesions 1, MAC/Perforin domain-containing protein (.1)
Potri.004G047700 204 / 5e-63 AT1G28380 809 / 0.0 necrotic spotted lesions 1, MAC/Perforin domain-containing protein (.1)
Potri.008G136401 167 / 2e-49 AT1G14780 691 / 0.0 MAC/Perforin domain-containing protein (.1)
Potri.010G104600 161 / 4e-47 AT1G14780 697 / 0.0 MAC/Perforin domain-containing protein (.1)
Potri.002G234700 161 / 6e-47 AT1G14780 520 / 8e-179 MAC/Perforin domain-containing protein (.1)
Potri.004G064000 141 / 6e-40 AT1G29690 901 / 0.0 constitutively activated cell death 1, MAC/Perforin domain-containing protein (.1)
Potri.006G107900 131 / 5e-36 AT1G29690 703 / 0.0 constitutively activated cell death 1, MAC/Perforin domain-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0293 CDC PF01823 MACPF MAC/Perforin domain
Representative CDS sequence
>Lus10000175 pacid=23149316 polypeptide=Lus10000175 locus=Lus10000175.g ID=Lus10000175.BGIv1.0 annot-version=v1.0
ATGGCACTCAGACTTCCTGCTCCACAGGCAGCTGAGATTGCAATTGGCTCCATAGGGCTTGGATATGACATTGCAGTCGATCTGAGGTTAAAATACCGAA
AAGTAGATGTAAATGATTCACGCTTGATTGAGATTGATGAGGACGGTGGTCGAGAGATCGGACTGCCTGGTGGGTTTGTCATCCCAAATGTCCCAAAATC
AATTAAATGTGATAAAGGTGAAAGAACGAGGTTTAGATCAGATGTTCTGTCTTTCCAGCAGATGTCGGAGCAGTTCAACCAGGAAATGTCTCTAACAGGA
AAAATACCCTCTGGACTCTTCAATACCATGTTTGAATTCTCAAGCTGCTGGCAGAAAGATGCAGCTAACACCAAAACCCTTTCTTTTGATGGGGTATTCA
TTACACTATACTCAGTTGCACTGGAGAAATCTCAGATTGTTCTCTGTGATCATGTTAAGAAGGCAGTCCCGTCATCGTGGGAACCAGCTGCCCTGGCCAA
GTAA
AA sequence
>Lus10000175 pacid=23149316 polypeptide=Lus10000175 locus=Lus10000175.g ID=Lus10000175.BGIv1.0 annot-version=v1.0
MALRLPAPQAAEIAIGSIGLGYDIAVDLRLKYRKVDVNDSRLIEIDEDGGREIGLPGGFVIPNVPKSIKCDKGERTRFRSDVLSFQQMSEQFNQEMSLTG
KIPSGLFNTMFEFSSCWQKDAANTKTLSFDGVFITLYSVALEKSQIVLCDHVKKAVPSSWEPAALAK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G24290 MAC/Perforin domain-containing... Lus10000175 0 1
AT5G24710 Transducin/WD40 repeat-like su... Lus10028093 3.7 0.8852
AT3G07660 Kinase-related protein of unkn... Lus10036414 6.3 0.8867
AT2G42520 P-loop containing nucleoside t... Lus10015977 8.2 0.8844
AT3G07660 Kinase-related protein of unkn... Lus10041089 9.8 0.8845
AT3G15880 WSIP2, TPR4 TOPLESS-RELATED 4, WUS-interac... Lus10043258 12.0 0.8827
AT1G59610 DRP2B, CF1, ADL... Dynamin related protein 2B, dy... Lus10007887 12.7 0.8836
AT4G16180 unknown protein Lus10017062 18.5 0.8830
AT2G42520 P-loop containing nucleoside t... Lus10029337 19.9 0.8776
AT5G06970 Protein of unknown function (D... Lus10026160 20.4 0.8650
AT4G25610 C2H2ZnF C2H2-like zinc finger protein ... Lus10027491 21.2 0.8613

Lus10000175 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.