Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14320 173 / 1e-57 Zinc-binding ribosomal protein family protein (.1.2) AT3G23390 173 / 1e-57 Zinc-binding ribosomal protein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040983 [exp] 179 / 3e-60 AT3G23390 199 / 4e-68 Zinc-binding ribosomal protein family protein (.1) Lus10038130 [exp] 179 / 3e-60 AT4G14320 199 / 4e-68 Zinc-binding ribosomal protein family protein (.1.2) Lus10013436 [exp] 179 / 3e-60 AT3G23390 199 / 4e-68 Zinc-binding ribosomal protein family protein (.1) Lus10010195 [exp] 179 / 3e-60 AT4G14320 199 / 4e-68 Zinc-binding ribosomal protein family protein (.1.2) Lus10017396 [exp] 179 / 6e-60 AT4G14320 199 / 7e-68 Zinc-binding ribosomal protein family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G251500 [exp] 178 / 1e-59 AT4G14320 175 / 2e-58 Zinc-binding ribosomal protein family protein (.1.2) Potri.007G071800 [exp] 178 / 1e-59 AT4G14320 175 / 2e-58 Zinc-binding ribosomal protein family protein (.1.2) Potri.005G092500 [exp] 176 / 1e-58 AT4G14320 171 / 4e-57 Zinc-binding ribosomal protein family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF00935 [flax] [poplar] Ribosomal_L44 Ribosomal protein L44
Representative CDS sequence Show only first row Show all	>Lus10000176 pacid=23139516 polypeptide=Lus10000176 locus=Lus10000176.g ID=Lus10000176.BGIv1.0 annot-version=v1.0 ATGGTGAACGTACCAAAGACAAAGAAGACGTATTGCAAGAGCAAGGAGTGCAAAAAGCACACCTTGCATAAGGTTACACAGTATAAAAAGGGAAAGGATA GTCTGGCTGCCCAAGGAAAGCGTCGTTATGACCGCAAACAGTCAGGTTATGGAGGTCAAACCAAGCCTGTCTTTCACAAGAAGGCTAAAACTACAAAGAA GATCGTGTTGAGGTTACAATGCCAAGGTTGCAAGCACGTCTCCCAGCATCCAATCAAGAGGTGCAAGCACTTTGAGATTGGAGGTGACAAGAAGGGGAAA GGAACGTCTCTCTTTTAA
AA sequence Show only first row Show all	>Lus10000176 pacid=23139516 polypeptide=Lus10000176 locus=Lus10000176.g ID=Lus10000176.BGIv1.0 annot-version=v1.0 MVNVPKTKKTYCKSKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLQCQGCKHVSQHPIKRCKHFEIGGDKKGK GTSLF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G14320			Zinc-binding ribosomal protein...		Lus10000176 [exp]	0	1
AT4G14320			Zinc-binding ribosomal protein...		Lus10038130 [exp]	1.4	0.9733
AT4G09800		RPS18C	S18 ribosomal protein (.1)		Lus10022057 [exp]	2.4	0.9697
AT1G22780		RPS18A, PFL1, P...	40S RIBOSOMAL PROTEIN S18, POI...		Lus10042603 [exp]	3.0	0.9674
AT4G09320		NDPK1	Nucleoside diphosphate kinase ...		Lus10003844 [exp]	4.5	0.9665
AT3G06700			Ribosomal L29e protein family ...		Lus10016875 [exp]	5.5	0.9582
AT1G07770		RPS15A	ribosomal protein S15A (.1.2)		Lus10043001 [exp]	5.7	0.9415
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10023730 [exp]	6.0	0.9467
AT4G29430		RPS15AE	ribosomal protein S15A E (.1)		Lus10000975 [exp]	6.5	0.9333
AT3G06700			Ribosomal L29e protein family ...		Lus10037740 [exp]	7.7	0.9506
AT3G02080			Ribosomal protein S19e family ...		Lus10032992 [exp]	8.4	0.9396

Compare expression of checked genes

Lus10000176 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.