Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12080 42 / 4e-06 AT-hook ATAHL1, AHL1 AT-hook motif nuclear-localized protein 1 (.1) AT5G51590 39 / 6e-05 AT-hook AT hook motif DNA-binding family protein (.1) AT4G22770 39 / 8e-05 AT-hook AT hook motif DNA-binding family protein (.1) AT5G46640 39 / 9e-05 AT-hook AT hook motif DNA-binding family protein (.1) AT5G62260 37 / 0.0003 AT-hook AT hook motif DNA-binding family protein (.1) AT4G25320 37 / 0.0004 AT-hook AT hook motif DNA-binding family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000381 [exp] 123 / 2e-36 AT4G12080 184 / 5e-56 AT-hook motif nuclear-localized protein 1 (.1) Lus10007003 [exp] 90 / 2e-23 AT4G12080 197 / 6e-61 AT-hook motif nuclear-localized protein 1 (.1) Lus10004318 [exp] 58 / 2e-11 AT4G12080 305 / 3e-102 AT-hook motif nuclear-localized protein 1 (.1) Lus10000315 [exp] 37 / 0.0003 AT2G33620 228 / 4e-72 AT hook motif DNA-binding family protein (.1.2.3.4) Lus10011067 [exp] 37 / 0.0003 AT2G33620 225 / 4e-71 AT hook motif DNA-binding family protein (.1.2.3.4) Lus10030962 [exp] 37 / 0.0003 AT4G17950 235 / 2e-73 AT hook motif DNA-binding family protein (.1) Lus10008533 [exp] 37 / 0.0005 AT1G63470 292 / 7e-97 AT hook motif DNA-binding family protein (.1) Lus10031118 [exp] 36 / 0.0006 AT4G25320 231 / 2e-74 AT hook motif DNA-binding family protein (.1) Lus10040085 [exp] 36 / 0.0008 AT4G17950 241 / 9e-76 AT hook motif DNA-binding family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G115800 [exp] 59 / 7e-12 AT4G12080 248 / 2e-80 AT-hook motif nuclear-localized protein 1 (.1) Potri.002G148600 [exp] 44 / 1e-06 AT4G12080 248 / 2e-80 AT-hook motif nuclear-localized protein 1 (.1) Potri.003G116500 [exp] 40 / 2e-05 AT4G12080 251 / 2e-81 AT-hook motif nuclear-localized protein 1 (.1) Potri.014G070000 [exp] 40 / 2e-05 AT4G12080 233 / 2e-74 AT-hook motif nuclear-localized protein 1 (.1) Potri.002G005000 [exp] 38 / 0.0001 AT2G33620 228 / 8e-72 AT hook motif DNA-binding family protein (.1.2.3.4) Potri.002G158200 [exp] 37 / 0.0002 AT2G45850 219 / 4e-69 AT hook motif DNA-binding family protein (.1.2) Potri.003G090900 [exp] 37 / 0.0003 AT4G17950 216 / 3e-66 AT hook motif DNA-binding family protein (.1) Potri.001G143500 [exp] 37 / 0.0003 AT4G17950 243 / 9e-77 AT hook motif DNA-binding family protein (.1) Potri.012G129500 [exp] 37 / 0.0003 AT5G62260 202 / 2e-61 AT hook motif DNA-binding family protein (.1) Potri.005G256500 [exp] 37 / 0.0004 AT2G33620 196 / 2e-59 AT hook motif DNA-binding family protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02178 [flax] [poplar] AT_hook AT hook motif
Representative CDS sequence Show only first row Show all	>Lus10000177 pacid=23143167 polypeptide=Lus10000177 locus=Lus10000177.g ID=Lus10000177.BGIv1.0 annot-version=v1.0 ATGACCGAGGAGGTTCCGGCGAAGAGAAAGCGAGGGAGGCCGAGGAAGTACAACCCAGATGGGAGTCTTGCGACCTCGGCTCGCTTCAAGAAGCCGATTT CCACCGCTGGGTCGGCTCCGCCGCCGGTGATTGATTTCTCGTCTGGGAAGCGGCCCAGAGTGAATGAGCCTAAGGAAAAGTCGTCTTATGGTGAGCTCGC TGACGGTTAA
AA sequence Show only first row Show all	>Lus10000177 pacid=23143167 polypeptide=Lus10000177 locus=Lus10000177.g ID=Lus10000177.BGIv1.0 annot-version=v1.0 MTEEVPAKRKRGRPRKYNPDGSLATSARFKKPISTAGSAPPPVIDFSSGKRPRVNEPKEKSSYGELADG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12080	AT-hook	ATAHL1, AHL1	AT-hook motif nuclear-localize...		Lus10000177 [exp]	0	1
AT4G12080	AT-hook	ATAHL1, AHL1	AT-hook motif nuclear-localize...		Lus10000381 [exp]	2.2	0.7830
AT4G18335			unknown protein		Lus10028125 [exp]	9.4	0.6472
AT3G25180		CYP82G1	cytochrome P450, family 82, su...		Lus10016287 [exp]	10.4	0.6892
					Lus10030116 [exp]	11.6	0.6503
AT4G12080	AT-hook	ATAHL1, AHL1	AT-hook motif nuclear-localize...		Lus10007003 [exp]	15.0	0.6080
AT1G62310			transcription factor jumonji (...		Lus10004603 [exp]	23.4	0.5570
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001037 [exp]	24.0	0.5832
AT5G12060			Plant self-incompatibility pro...		Lus10023085 [exp]	29.5	0.5504
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10006693 [exp]	30.5	0.5504
AT5G61000		ATRPA70D	Replication factor-A protein 1...		Lus10003025 [exp]	31.2	0.6215

Compare expression of checked genes

Lus10000177 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.