Lus10000183 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G37510 190 / 2e-57 CI76, EMB1467 embryo defective 1467, NADH-ubiquinone dehydrogenase, mitochondrial, putative (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009539 114 / 6e-30 AT5G37510 672 / 0.0 embryo defective 1467, NADH-ubiquinone dehydrogenase, mitochondrial, putative (.1.2)
Lus10020363 114 / 6e-30 AT5G37510 1140 / 0.0 embryo defective 1467, NADH-ubiquinone dehydrogenase, mitochondrial, putative (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G136133 200 / 5e-61 AT5G37510 1252 / 0.0 embryo defective 1467, NADH-ubiquinone dehydrogenase, mitochondrial, putative (.1.2)
Potri.004G082800 197 / 5e-60 AT5G37510 1248 / 0.0 embryo defective 1467, NADH-ubiquinone dehydrogenase, mitochondrial, putative (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0486 Fer2 PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Representative CDS sequence
>Lus10000183 pacid=23175243 polypeptide=Lus10000183 locus=Lus10000183.g ID=Lus10000183.BGIv1.0 annot-version=v1.0
ATGGGACTGGGGTTACTAGCTTCGCGGGTCATCAGGCCCCACGTGGCCTCCAGGAATCTCTTCCTCCTACGCTCAATCGTCACCAAGCCGGAGCTTCAAT
CCCCCGAGGCCGCCGCTGCAGCTGCAGCTCCGGAGCCGAAACCAGATCTCCCGCCGCGGACGCCGGTGGCGGGAGCTAGGGTGCACTTCTCCAACCCGGA
GGACGCGATCGAGGTGTTCGTCGATGGATATCCGGTGAAAATCCCCAAGGGGATGACCGTTCTCCAGGCCTGTGAGGTGGCCGGAGTCGATATCCCGAGG
TTCTGTTATCATAGCCGGCTGTCGATCGCTGGGAACTGTAGGATGTGTCTCGTTGAGGTCGAGAAGTCGCCCAAGCCTGTAGCTTCATGCGCCATGCCTG
CTCTTCCTGTACGGAAGTTATCTAGCATGTATGCTGGAACGGAAAAGTAG
AA sequence
>Lus10000183 pacid=23175243 polypeptide=Lus10000183 locus=Lus10000183.g ID=Lus10000183.BGIv1.0 annot-version=v1.0
MGLGLLASRVIRPHVASRNLFLLRSIVTKPELQSPEAAAAAAAPEPKPDLPPRTPVAGARVHFSNPEDAIEVFVDGYPVKIPKGMTVLQACEVAGVDIPR
FCYHSRLSIAGNCRMCLVEVEKSPKPVASCAMPALPVRKLSSMYAGTEK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G37510 CI76, EMB1467 embryo defective 1467, NADH-ub... Lus10000183 0 1
AT1G56070 LOS1, AT1G56075... LOW EXPRESSION OF OSMOTICALLY ... Lus10031201 2.4 0.9294
AT2G32730 26S proteasome regulatory comp... Lus10007140 3.5 0.9311
AT3G49500 SDE1, SGS2, RDR... SUPPRESSOR OF GENE SILENCING 2... Lus10002909 3.5 0.9256
AT4G21150 HAP6 HAPLESS 6, ribophorin II (RPN2... Lus10024912 3.5 0.9306
AT1G56070 LOS1, AT1G56075... LOW EXPRESSION OF OSMOTICALLY ... Lus10031185 3.9 0.9205
AT5G57870 eIFiso4G1 eukaryotic translation Initiat... Lus10035813 4.9 0.8957
AT5G10540 Zincin-like metalloproteases f... Lus10004276 5.1 0.8934
AT1G79090 unknown protein Lus10031788 6.0 0.8893
AT3G12915 Ribosomal protein S5/Elongatio... Lus10031779 6.6 0.8971
AT2G25320 TRAF-like family protein (.1) Lus10002926 8.4 0.8994

Lus10000183 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.