Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44050 147 / 2e-45 COS1 coronatine insensitive1 suppressor, COI1 SUPPRESSOR1, 6,7-dimethyl-8-ribityllumazine synthase / DMRL synthase / lumazine synthase / riboflavin synthase (.1) AT3G54300 112 / 2e-31 ATVAMP727 vesicle-associated membrane protein 727 (.1.2) AT1G04760 102 / 1e-27 ATVAMP726 vesicle-associated membrane protein 726 (.1) AT1G04750 100 / 1e-27 ATVAMP7B, ATVAMP721, VAMP7B VESICLE-ASSOCIATED MEMBRANE PROTEIN 7B, vesicle-associated membrane protein 721 (.1.2) AT2G33120 100 / 4e-27 ATVAMP722, SAR1 ARABIDOPSIS THALIANA VESICLE-ASSOCIATED MEMBRANE PROTEIN 722, synaptobrevin-related protein 1 (.1.2.3) AT2G32670 100 / 3e-26 ATVAMP725 vesicle-associated membrane protein 725 (.1) AT4G15780 72 / 5e-16 ATVAMP724 vesicle-associated membrane protein 724 (.1) AT3G24890 68 / 2e-15 ATVAMP728 vesicle-associated membrane protein 728 (.1.2) AT2G33110 69 / 1e-14 ATVAMP723 vesicle-associated membrane protein 723 (.1) AT5G11150 61 / 5e-12 ATVAMP713 vesicle-associated membrane protein 713 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043431 [exp] 186 / 3e-58 AT3G54300 325 / 9e-111 vesicle-associated membrane protein 727 (.1.2) Lus10034145 [exp] 186 / 7e-58 AT3G54300 322 / 4e-109 vesicle-associated membrane protein 727 (.1.2) Lus10028541 [exp] 165 / 6e-52 AT2G44050 288 / 2e-99 coronatine insensitive1 suppressor, COI1 SUPPRESSOR1, 6,7-dimethyl-8-ribityllumazine synthase / DMRL synthase / lumazine synthase / riboflavin synthase (.1) Lus10018133 [exp] 163 / 4e-51 AT2G44050 289 / 1e-99 coronatine insensitive1 suppressor, COI1 SUPPRESSOR1, 6,7-dimethyl-8-ribityllumazine synthase / DMRL synthase / lumazine synthase / riboflavin synthase (.1) Lus10011870 [exp] 101 / 4e-27 AT1G04760 376 / 3e-134 vesicle-associated membrane protein 726 (.1) Lus10038342 [exp] 100 / 6e-27 AT1G04760 366 / 3e-130 vesicle-associated membrane protein 726 (.1) Lus10036203 [exp] 100 / 6e-27 AT1G04760 367 / 1e-130 vesicle-associated membrane protein 726 (.1) Lus10022804 [exp] 100 / 9e-27 AT1G04760 377 / 1e-134 vesicle-associated membrane protein 726 (.1) Lus10038166 [exp] 100 / 1e-26 AT1G04760 383 / 3e-137 vesicle-associated membrane protein 726 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G001800 [exp] 163 / 2e-51 AT2G44050 291 / 1e-100 coronatine insensitive1 suppressor, COI1 SUPPRESSOR1, 6,7-dimethyl-8-ribityllumazine synthase / DMRL synthase / lumazine synthase / riboflavin synthase (.1) Potri.007G146000 [exp] 157 / 3e-49 AT2G44050 279 / 6e-96 coronatine insensitive1 suppressor, COI1 SUPPRESSOR1, 6,7-dimethyl-8-ribityllumazine synthase / DMRL synthase / lumazine synthase / riboflavin synthase (.1) Potri.008G019400 [exp] 111 / 7e-31 AT3G54300 407 / 3e-146 vesicle-associated membrane protein 727 (.1.2) Potri.010G239900 [exp] 105 / 8e-29 AT3G54300 387 / 6e-138 vesicle-associated membrane protein 727 (.1.2) Potri.003G177700 [exp] 100 / 9e-27 AT1G04750 389 / 1e-139 VESICLE-ASSOCIATED MEMBRANE PROTEIN 7B, vesicle-associated membrane protein 721 (.1.2) Potri.002G240900 [exp] 100 / 1e-26 AT2G33120 355 / 3e-126 ARABIDOPSIS THALIANA VESICLE-ASSOCIATED MEMBRANE PROTEIN 722, synaptobrevin-related protein 1 (.1.2.3) Potri.015G118300 [exp] 99 / 2e-26 AT2G33120 359 / 8e-128 ARABIDOPSIS THALIANA VESICLE-ASSOCIATED MEMBRANE PROTEIN 722, synaptobrevin-related protein 1 (.1.2.3) Potri.012G119600 [exp] 97 / 8e-26 AT2G33120 363 / 2e-129 ARABIDOPSIS THALIANA VESICLE-ASSOCIATED MEMBRANE PROTEIN 722, synaptobrevin-related protein 1 (.1.2.3) Potri.001G050400 [exp] 97 / 1e-25 AT2G33120 365 / 4e-130 ARABIDOPSIS THALIANA VESICLE-ASSOCIATED MEMBRANE PROTEIN 722, synaptobrevin-related protein 1 (.1.2.3) Potri.008G209100 [exp] 69 / 7e-15 AT4G15780 367 / 9e-131 vesicle-associated membrane protein 724 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0445 [flax] [poplar] SNARE-fusion PF00957 [flax] [poplar] Synaptobrevin Synaptobrevin CL0445 [flax] [poplar] PF00885 [flax] [poplar] DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Representative CDS sequence Show only first row Show all	>Lus10000192 pacid=23167497 polypeptide=Lus10000192 locus=Lus10000192.g ID=Lus10000192.BGIv1.0 annot-version=v1.0 ATGCAGTACTGTATGGAACATCCCGAGGAGATTAGTAAGCTGTCCAAATTGAAGGCTCAAGTCACCGAAGTCAAGGGAATTATGATGGACAACATCGAGA AGGTTTTGGATCGTGGGGAGAAGATAGAACTTCTGGTTGATAAAACAGAGAATCTACAGTTTCAGGTTGTTGCCCGGTTCAATGAGATCGTGACTAGGGC GCTTTTGGAAGGAGCTATCGACACTTTCGGGAGGTATTCAGTCCCAGAAGAGAACATTGATGTTGTGTGGGTTCCTGGTTGTTTCGAAGTAGGGTTGGCC GCAGATAAGCTAGGCAAGTCAGGCAAGTACAATGCAGTGGTGTGCATTGCAGCTGTGGTAAGAGGCGACACCTCTCACTACGATGCAGTTGCAAACTCGG CTGCATCCGGAGTCCTCTCAGCTGGTCTGAATTCAGGTTGGTAA
AA sequence Show only first row Show all	>Lus10000192 pacid=23167497 polypeptide=Lus10000192 locus=Lus10000192.g ID=Lus10000192.BGIv1.0 annot-version=v1.0 MQYCMEHPEEISKLSKLKAQVTEVKGIMMDNIEKVLDRGEKIELLVDKTENLQFQVVARFNEIVTRALLEGAIDTFGRYSVPEENIDVVWVPGCFEVGLA ADKLGKSGKYNAVVCIAAVVRGDTSHYDAVANSAASGVLSAGLNSGW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G44050		COS1	coronatine insensitive1 suppre...		Lus10000192 [exp]	0	1
AT5G53550		ATYSL3, YSL3	YELLOW STRIPE like 3 (.1.2)		Lus10022365 [exp]	8.2	0.6388
					Lus10001095 [exp]	25.1	0.5862
AT3G23600			alpha/beta-Hydrolases superfam...		Lus10000668 [exp]	28.4	0.5796
AT3G23600			alpha/beta-Hydrolases superfam...		Lus10000665 [exp]	38.4	0.5862
AT3G05710		ATSYP43, SYP43	syntaxin of plants 43 (.1.2)		Lus10015215 [exp]	47.5	0.5279
AT3G21310			Core-2/I-branching beta-1,6-N-...		Lus10003499 [exp]	50.4	0.5241
AT5G35410		ATSOS2, CIPK24,...	SNF1-RELATED PROTEIN KINASE 3....		Lus10043267 [exp]	96.7	0.5345
AT2G43620			Chitinase family protein (.1)		Lus10020338 [exp]	103.2	0.4703
AT3G18790			unknown protein		Lus10008883 [exp]	151.5	0.4786
AT2G16730		BGAL13	beta-galactosidase 13, glycosy...		Lus10019784 [exp]	153.2	0.4545

Compare expression of checked genes

Lus10000192 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.