Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G21090 102 / 5e-29 Leucine-rich repeat (LRR) family protein (.1) AT3G43740 96 / 1e-26 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) AT1G71830 89 / 2e-22 ATSERK1, SERK1 somatic embryogenesis receptor-like kinase 1 (.1) AT1G34210 84 / 7e-21 ATSERK2, SERK2 somatic embryogenesis receptor-like kinase 2 (.1) AT4G33430 81 / 8e-20 SERK3, RKS10, ELG, BAK1, ATSERK3, ATBAK1 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2) AT2G13790 75 / 2e-17 BAK7, BKK1, ATSERK4 BAK1-LIKE 1, BRI1- ASSOCIATED KINASE 7, somatic embryogenesis receptor-like kinase 4 (.1) AT2G13800 61 / 9e-13 BAK8, ATSERK5 BRI1- ASSOCIATED KINASE 8, SOMATIC EMBRYOGENESIS RECEPTOR LIKE KINASE 5, somatic embryogenesis receptor-like kinase 5 (.1) AT1G25320 47 / 1e-07 Leucine-rich repeat protein kinase family protein (.1) AT4G30520 47 / 1e-07 SARK SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE, Leucine-rich repeat protein kinase family protein (.1) AT5G65240 46 / 2e-07 Leucine-rich repeat protein kinase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026751 [exp] 122 / 3e-37 AT5G21090 250 / 2e-85 Leucine-rich repeat (LRR) family protein (.1) Lus10004958 [exp] 85 / 4e-22 AT1G34210 215 / 2e-66 somatic embryogenesis receptor-like kinase 2 (.1) Lus10028716 [exp] 86 / 2e-21 AT1G71830 1000 / 0.0 somatic embryogenesis receptor-like kinase 1 (.1) Lus10013902 [exp] 85 / 5e-21 AT1G49870 454 / 2e-145 unknown protein Lus10020962 [exp] 83 / 2e-20 AT4G33430 989 / 0.0 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2) Lus10042755 [exp] 81 / 2e-20 AT5G21090 199 / 8e-65 Leucine-rich repeat (LRR) family protein (.1) Lus10001807 [exp] 79 / 1e-19 AT5G21090 227 / 9e-76 Leucine-rich repeat (LRR) family protein (.1) Lus10002579 [exp] 78 / 3e-19 AT5G21090 275 / 3e-94 Leucine-rich repeat (LRR) family protein (.1) Lus10002117 [exp] 77 / 5e-19 AT3G43740 273 / 9e-94 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G219500 [exp] 103 / 2e-29 AT5G21090 348 / 2e-123 Leucine-rich repeat (LRR) family protein (.1) Potri.009G018800 [exp] 102 / 7e-29 AT5G21090 354 / 6e-126 Leucine-rich repeat (LRR) family protein (.1) Potri.001G061600 [exp] 87 / 7e-23 AT5G21090 272 / 2e-93 Leucine-rich repeat (LRR) family protein (.1) Potri.003G166200 [exp] 87 / 7e-23 AT5G21090 275 / 2e-94 Leucine-rich repeat (LRR) family protein (.1) Potri.019G087700 [exp] 88 / 5e-22 AT1G34210 1012 / 0.0 somatic embryogenesis receptor-like kinase 2 (.1) Potri.013G117200 [exp] 87 / 5e-22 AT1G34210 1013 / 0.0 somatic embryogenesis receptor-like kinase 2 (.1) Potri.001G296500 [exp] 83 / 1e-21 AT3G43740 278 / 1e-95 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Potri.007G082400 [exp] 86 / 2e-21 AT1G34210 954 / 0.0 somatic embryogenesis receptor-like kinase 2 (.1) Potri.003G023000 [exp] 84 / 6e-21 AT4G33430 961 / 0.0 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2) Potri.005G083300 [exp] 84 / 8e-21 AT1G71830 981 / 0.0 somatic embryogenesis receptor-like kinase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08263 [flax] [poplar] LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10000196 pacid=23149886 polypeptide=Lus10000196 locus=Lus10000196.g ID=Lus10000196.BGIv1.0 annot-version=v1.0 ATGGCGGCGGCTGCACCTCTCATCTTCGCTGCTGTTGCTCTAGCCCTGTGCTTCCCTCTCGCGTTTGCGAATTCGGAAGGAGATGCTCTCTACACACTTA GGAGGAGCTTGTCCGATCCGGATAACGTCCTCCAGAGCTGGGATCCGACCTTAGTCAACCCTTGCACTTGGTTCCACATCACCTGCAACCAGGATAACCG CGTTACCCGAGTGTAA
AA sequence Show only first row Show all	>Lus10000196 pacid=23149886 polypeptide=Lus10000196 locus=Lus10000196.g ID=Lus10000196.BGIv1.0 annot-version=v1.0 MAAAAPLIFAAVALALCFPLAFANSEGDALYTLRRSLSDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G21090			Leucine-rich repeat (LRR) fami...		Lus10000196 [exp]	0	1
AT5G57685		LSB1, ATGDU3	LESS SUSCEPTIBLE TO BSCTV 1, A...		Lus10006986 [exp]	3.5	0.8694
AT1G55910		ZIP11	zinc transporter 11 precursor ...		Lus10016609 [exp]	4.1	0.8804
AT1G55190		PRA7, PRA1.F2	PRENYLATED RAB ACCEPTOR 1.F2, ...		Lus10034363 [exp]	5.5	0.8723
AT5G09620			Octicosapeptide/Phox/Bem1p fam...		Lus10010753 [exp]	6.0	0.8458
AT1G47750		PEX11A	peroxin 11A (.1)		Lus10029260 [exp]	10.0	0.8683
AT1G70230		AXY4, TBL27	ALTERED XYLOGLUCAN 4, TRICHOME...		Lus10029188 [exp]	13.7	0.8284
AT2G45630			D-isomer specific 2-hydroxyaci...		Lus10041393 [exp]	14.8	0.8415
AT5G35732			unknown protein		Lus10006404 [exp]	18.8	0.8391
AT3G48560		TZP5, IMR1, ALS...	TRIAZOLOPYRIMIDINE RESISTANT 5...		Lus10035359 [exp]	19.9	0.8373
AT1G65720			unknown protein		Lus10010961 [exp]	20.0	0.8614

Compare expression of checked genes

Lus10000196 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.