Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39710 90 / 3e-24 PnsL4, FKBP16-2 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) AT5G45680 51 / 2e-09 ATFKBP13 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) AT5G05420 39 / 2e-05 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT1G18170 35 / 0.0009 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G25340 35 / 0.0009 ATFKBP53 FK506 BINDING PROTEIN 53 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022507 [exp] 117 / 5e-35 AT4G39710 270 / 8e-93 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) Lus10016811 [exp] 117 / 5e-35 AT4G39710 271 / 5e-93 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) Lus10024735 [exp] 55 / 4e-11 AT5G45680 194 / 1e-63 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Lus10006949 [exp] 52 / 7e-10 AT5G45680 244 / 2e-82 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Lus10031342 [exp] 37 / 0.0003 AT1G18170 261 / 3e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10031121 [exp] 37 / 0.0004 AT4G25340 335 / 3e-110 FK506 BINDING PROTEIN 53 (.1.2) Lus10035560 [exp] 37 / 0.0004 AT3G10060 296 / 2e-102 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10038215 [exp] 36 / 0.0006 AT3G25210 368 / 4e-125 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10031700 [exp] 36 / 0.0006 AT4G25340 324 / 3e-105 FK506 BINDING PROTEIN 53 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G079700 [exp] 95 / 4e-26 AT4G39710 243 / 1e-81 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) Potri.007G087401 [exp] 78 / 3e-20 AT4G39710 158 / 1e-49 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) Potri.001G075500 [exp] 51 / 1e-09 AT5G45680 253 / 7e-86 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Potri.012G129200 [exp] 38 / 0.0001 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2) Potri.015G130900 [exp] 38 / 0.0001 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2) Potri.002G248200 [exp] 37 / 0.0001 AT5G48580 228 / 1e-77 FK506- and rapamycin-binding protein 15 kD-2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [flax] [poplar] FKBP PF00254 [flax] [poplar] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Lus10000197 pacid=23166578 polypeptide=Lus10000197 locus=Lus10000197.g ID=Lus10000197.BGIv1.0 annot-version=v1.0 ATGGGAAGTGTTATATTTGGTCATACAGGTGGGAAGCGTAGGCTTTACATTCCTCCAAAGTTAGCATATGGACCAGAACCTGCAGGGTGCTTCTCAGGTG ACTGCAACATCCCTGGGAATGCCACGCTAGTCTACGATATCAAATTCGTGGAGGTTTACTCAGGAAACAGAAAGTTAACCAATCCCTGA
AA sequence Show only first row Show all	>Lus10000197 pacid=23166578 polypeptide=Lus10000197 locus=Lus10000197.g ID=Lus10000197.BGIv1.0 annot-version=v1.0 MGSVIFGHTGGKRRLYIPPKLAYGPEPAGCFSGDCNIPGNATLVYDIKFVEVYSGNRKLTNP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39710		PnsL4, FKBP16-2	Photosynthetic NDH subcomplex...		Lus10000197 [exp]	0	1
AT5G27290			unknown protein		Lus10033822 [exp]	2.0	0.9492
AT1G49975			unknown protein		Lus10033771 [exp]	6.0	0.9400
AT3G22210			unknown protein		Lus10003811 [exp]	6.0	0.9103
AT3G16250		PnsB3, NDF4	Photosynthetic NDH subcomplex...		Lus10038292 [exp]	6.2	0.9453
AT3G16250		PnsB3, NDF4	Photosynthetic NDH subcomplex...		Lus10025809 [exp]	6.9	0.9408
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10040736 [exp]	7.1	0.9226
AT4G18370		DEGP5, DEG5, HH...	PROTEASE HHOA PRECUSOR, DEGP p...		Lus10042822 [exp]	8.7	0.9378
AT4G31115			Protein of unknown function (D...		Lus10026864 [exp]	9.9	0.9326
AT1G70760		NdhL, CRR23	NADH dehydrogenase-like comple...		Lus10012886 [exp]	12.4	0.9316
AT1G74410			RING/U-box superfamily protein...		Lus10001654 [exp]	14.5	0.9250

Compare expression of checked genes

Lus10000197 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.