Lus10000201 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G03050 53 / 7e-09 ENTH/ANTH/VHS superfamily protein (.1)
AT4G02650 51 / 2e-08 ENTH/ANTH/VHS superfamily protein (.1)
AT2G25430 42 / 6e-05 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related (.1)
AT4G32285 40 / 0.0003 ENTH/ANTH/VHS superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020824 94 / 3e-23 AT1G03050 636 / 0.0 ENTH/ANTH/VHS superfamily protein (.1)
Lus10012686 93 / 1e-22 AT1G03050 642 / 0.0 ENTH/ANTH/VHS superfamily protein (.1)
Lus10002920 45 / 4e-06 AT2G25430 909 / 0.0 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related (.1)
Lus10001502 45 / 5e-06 AT2G25430 914 / 0.0 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related (.1)
Lus10019402 39 / 0.0004 AT2G25430 580 / 0.0 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related (.1)
Lus10043260 39 / 0.0005 AT4G32285 506 / 2e-173 ENTH/ANTH/VHS superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G118100 72 / 2e-15 AT1G03050 605 / 0.0 ENTH/ANTH/VHS superfamily protein (.1)
Potri.006G255000 50 / 1e-07 AT2G25430 866 / 0.0 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related (.1)
Potri.018G026900 48 / 5e-07 AT2G25430 857 / 0.0 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related (.1)
Potri.006G066900 47 / 7e-07 AT4G32285 665 / 0.0 ENTH/ANTH/VHS superfamily protein (.1.2)
Potri.018G128200 44 / 6e-06 AT4G32285 626 / 0.0 ENTH/ANTH/VHS superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10000201 pacid=23142391 polypeptide=Lus10000201 locus=Lus10000201.g ID=Lus10000201.BGIv1.0 annot-version=v1.0
ATGTCTAGTGTGGGTGGGTACGGAAGAGTGAGTGGAAGTGCTAGCAGTGTTGCACTTGGTTCAGCTGGTAGACCTGCAATGCTTGCTTTACCTGCCCCTC
CAACATCGTCGAATTACTCGTGCGGTGGGTTTTCGGACCCTTTTGCAGCATCGATTGCGGTGCCCCCACCACCGTATGTGCAGATGTCAGAGATGGAGAG
GAAGCAACAATTATTGATGGAGGAACAACTAATGTGGCAACAATATGCAAAAAATGGTATGCAAGGGCATGTTGGGTTTGTTAACGTAAAACAACAGAAT
ACTTGCAACTTCCAACATAATACTTGCAACTTCAACATAATACTTACAACATACAAAATACTGGGACATACCCATACACACGGGGCTTACCACTTTGTTT
GA
AA sequence
>Lus10000201 pacid=23142391 polypeptide=Lus10000201 locus=Lus10000201.g ID=Lus10000201.BGIv1.0 annot-version=v1.0
MSSVGGYGRVSGSASSVALGSAGRPAMLALPAPPTSSNYSCGGFSDPFAASIAVPPPPYVQMSEMERKQQLLMEEQLMWQQYAKNGMQGHVGFVNVKQQN
TCNFQHNTCNFNIILTTYKILGHTHTHGAYHFV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G03050 ENTH/ANTH/VHS superfamily prot... Lus10000201 0 1
AT2G29490 GST19, ATGSTU1 GLUTATHIONE S-TRANSFERASE 19, ... Lus10007896 6.1 0.8427
AT4G15733 SCRL11 SCR-like 11 (.1) Lus10042791 10.5 0.7688
AT3G50845 Protein of unknown function (D... Lus10014311 13.2 0.8023
AT3G56960 PIP5K4 phosphatidyl inositol monophos... Lus10039011 14.7 0.7273
Lus10013963 15.6 0.7919
AT3G03530 NPC4 non-specific phospholipase C4 ... Lus10028492 15.9 0.7536
Lus10025503 16.7 0.7822
AT3G53690 RING/U-box superfamily protein... Lus10042610 25.5 0.7657
Lus10007508 27.5 0.7657
AT1G04670 unknown protein Lus10004041 29.4 0.7657

Lus10000201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.