Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33680 117 / 5e-32 AGD2 ABERRANT GROWTH AND DEATH 2, Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) AT2G13810 75 / 1e-16 EDTS5, ALD1 eds two suppressor 5, AGD2-like defense response protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035646 [exp] 216 / 1e-69 AT4G33680 723 / 0.0 ABERRANT GROWTH AND DEATH 2, Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Lus10010748 [exp] 201 / 5e-64 AT4G33680 724 / 0.0 ABERRANT GROWTH AND DEATH 2, Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Lus10020959 [exp] 89 / 2e-21 AT2G13810 587 / 0.0 eds two suppressor 5, AGD2-like defense response protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G082100 [exp] 122 / 9e-34 AT4G33680 736 / 0.0 ABERRANT GROWTH AND DEATH 2, Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Potri.007G013200 [exp] 97 / 2e-24 AT2G13810 644 / 0.0 eds two suppressor 5, AGD2-like defense response protein 1 (.1) Potri.005G115800 [exp] 96 / 5e-24 AT2G13810 601 / 0.0 eds two suppressor 5, AGD2-like defense response protein 1 (.1) Potri.002G091500 [exp] 79 / 4e-18 AT2G13810 581 / 0.0 eds two suppressor 5, AGD2-like defense response protein 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000205 pacid=23155616 polypeptide=Lus10000205 locus=Lus10000205.g ID=Lus10000205.BGIv1.0 annot-version=v1.0 ATGGCTCTTCATCACCATCTCAACGCCTCCATCTCTTCCTCTTCCTCGCCTCTCCTTTCTCCAACTTCTGCATTCAATTCCTCCTCCGGGAATCGGACTG TTTCTCTTCGGCCTCGAAACTTTGGGATTTGCAGAAGCGTCGCCACTTCTCAACCAGATAAGACTGAGACCGCTTATAAAACGAATGTCTCTCGCAATGC CAACATGGGGAAGCTTCAAGCTGGTTACTTGTTCCCAGAGGTTGCTAGAAGAAGGAATGCCCACAAAGAGAAATACCCTGATGCTGAAGTGATAAGCCTT GGTATAGGAGACACTACGGAGCCCATTCCGGATGTGATTACTTCTGCGATGTCTAAGGTACTGGTGCCTTTTGTTTACTCGTAA
AA sequence Show only first row Show all	>Lus10000205 pacid=23155616 polypeptide=Lus10000205 locus=Lus10000205.g ID=Lus10000205.BGIv1.0 annot-version=v1.0 MALHHHLNASISSSSSPLLSPTSAFNSSSGNRTVSLRPRNFGICRSVATSQPDKTETAYKTNVSRNANMGKLQAGYLFPEVARRRNAHKEKYPDAEVISL GIGDTTEPIPDVITSAMSKVLVPFVYS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33680		AGD2	ABERRANT GROWTH AND DEATH 2, P...		Lus10000205 [exp]	0	1
AT3G17970		ATTOC64-III	translocon at the outer membra...		Lus10009050 [exp]	7.7	0.8545
AT2G03640			Nuclear transport factor 2 (NT...		Lus10004644 [exp]	15.9	0.7829
AT3G52140			tetratricopeptide repeat (TPR)...		Lus10015708 [exp]	21.3	0.8387
AT5G57990		UBP23	ubiquitin-specific protease 23...		Lus10035825 [exp]	21.8	0.8412
AT3G23950			F-box family protein (.1)		Lus10040838 [exp]	23.2	0.7767
AT1G80410		OMA, EMB2753	OMISHA, EMBRYO DEFECTIVE 2753,...		Lus10023111 [exp]	24.8	0.8410
AT4G15850		ATRH1	RNA helicase 1 (.1)		Lus10042818 [exp]	27.1	0.8296
AT1G09620			ATP binding;leucine-tRNA ligas...		Lus10024704 [exp]	36.5	0.8381
AT5G01590			unknown protein		Lus10022672 [exp]	40.2	0.8173
AT1G14610		VALRS, TWN2	VALYL TRNA SYNTHETASE, TWIN 2,...		Lus10033331 [exp]	44.0	0.8266

Compare expression of checked genes

Lus10000205 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.