Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45530 45 / 3e-07 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033252 [exp] 79 / 9e-20 AT2G45530 258 / 7e-87 RING/U-box superfamily protein (.1) Lus10008286 [exp] 79 / 1e-19 AT2G45530 258 / 1e-86 RING/U-box superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G149200 [exp] 61 / 7e-13 AT2G45530 236 / 3e-78 RING/U-box superfamily protein (.1) Potri.001G452800 [exp] 59 / 3e-12 AT2G45530 259 / 3e-87 RING/U-box superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000211 pacid=23173313 polypeptide=Lus10000211 locus=Lus10000211.g ID=Lus10000211.BGIv1.0 annot-version=v1.0 ATGGTTGTGGTTGCTGATTTGGAACTTGATGAGGTTGGAACGAGAATCGTGGCATCGAGACTAAACATGAGTTATACAGGTGTGATCGTTGTGATTGGAC TAGGAACTGCACTGAGGTTGGCTCTGGAGTTCTGCAACGAATGGAGTTCTAGGAGAGGAGTTCACCGGGTGGATGCGAATGTAAATCTCGGGTATCATCC CGCATTATAG
AA sequence Show only first row Show all	>Lus10000211 pacid=23173313 polypeptide=Lus10000211 locus=Lus10000211.g ID=Lus10000211.BGIv1.0 annot-version=v1.0 MVVVADLELDEVGTRIVASRLNMSYTGVIVVIGLGTALRLALEFCNEWSSRRGVHRVDANVNLGYHPAL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G45530			RING/U-box superfamily protein...		Lus10000211 [exp]	0	1
AT3G03890			FMN binding (.1.2)		Lus10013617 [exp]	2.0	0.8500
AT1G14340			RNA-binding (RRM/RBD/RNP motif...		Lus10007254 [exp]	4.5	0.8295
AT1G49950	MYB	ATTRB1, TRB1	telomere repeat binding factor...		Lus10025203 [exp]	4.6	0.8469
AT4G35980			unknown protein		Lus10041889 [exp]	5.5	0.8477
AT2G28930		APK1B	protein kinase 1B (.1.2.3)		Lus10005462 [exp]	6.5	0.8364
AT1G55310		ATSCL33, SR33, ...	SC35-like splicing factor 33 (...		Lus10013539 [exp]	8.0	0.8226
AT3G14630		CYP72A9	"cytochrome P450, family 72, s...		Lus10019188 [exp]	8.8	0.8409
AT2G46080			unknown protein		Lus10005122 [exp]	10.4	0.8461
AT1G60430		ARPC3	actin-related protein C3 (.1.2...		Lus10018909 [exp]	14.4	0.8264
AT5G01800			saposin B domain-containing pr...		Lus10022750 [exp]	15.0	0.8440

Compare expression of checked genes

Lus10000211 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.