Lus10000215 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G03720 69 / 1e-13 CAT4 cationic amino acid transporter 4 (.1.2)
AT1G58030 67 / 6e-13 CAT2 cationic amino acid transporter 2 (.1)
AT5G36940 0 / 1 CAT3 cationic amino acid transporter 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020305 131 / 3e-35 AT1G58030 805 / 0.0 cationic amino acid transporter 2 (.1)
Lus10005687 114 / 2e-29 AT3G03720 803 / 0.0 cationic amino acid transporter 4 (.1.2)
Lus10001334 58 / 1e-09 AT1G58030 973 / 0.0 cationic amino acid transporter 2 (.1)
Lus10013638 57 / 6e-05 AT1G58030 964 / 0.0 cationic amino acid transporter 2 (.1)
Lus10005671 56 / 6e-05 AT1G58030 958 / 0.0 cationic amino acid transporter 2 (.1)
Lus10020322 56 / 6e-05 AT1G58030 949 / 0.0 cationic amino acid transporter 2 (.1)
Lus10020320 56 / 6e-05 AT1G58030 912 / 0.0 cationic amino acid transporter 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G039700 59 / 2e-06 AT1G58030 924 / 0.0 cationic amino acid transporter 2 (.1)
Potri.019G039600 67 / 5e-06 AT3G03720 797 / 0.0 cationic amino acid transporter 4 (.1.2)
Potri.013G065000 56 / 0.0003 AT1G58030 873 / 0.0 cationic amino acid transporter 2 (.1)
PFAM info
Representative CDS sequence
>Lus10000215 pacid=23180208 polypeptide=Lus10000215 locus=Lus10000215.g ID=Lus10000215.BGIv1.0 annot-version=v1.0
ATGATTGATACGATTTCTTGCAACAGAAGTTATCGTAAGGGCTTTTTTGTAATTTTCTTCCTTGAACAGGTTAGTGTGGGGACACTACTTGCATTCACTG
CTGTTGCAGTATCCGTCCTGATACTAAGATACGTTCCTCCGGATGTGGTGCCAGTTCCCTCGTCCCTTCACGGCACGATTGATGTTTCGCCTTTGCTGCT
TGGTGATGATGATGTTGAGGAAGTCAAGTTCTTCGATCATGGTAAAGCCTTGCATCACAGTGAAGGGACATCGGTTAGCAAATCTCTCGGTCACAAACCG
ATCGTTCAAGTGGGCGGAGGTCTTCTCTTGTGTGGCTCGGTCGTCCTAGCTTGTATAGCTCAAGATAACGGGAGGCACAGCTTTGGACACACAGGAGGTT
TCACTTGCCCTTTGGTCCCGTATCTACCGGTCGCTTGCATCCTGGGGCGAGACATGGCTCCGCGTGTCGCTATGGCTACTGATCGGGGCGCTTATCTACG
TGTTCTATGGTCGGAATCACAGCTCTCTGATAGATGCCGTCTATGTTCCTACTGCTCATGCAAAGAAGGCACATTACGCTTCGTCGTCGCGATCATGAAG
ACAAATCCGAGCTCTGGCCCGAGACTTGAGCTTTAA
AA sequence
>Lus10000215 pacid=23180208 polypeptide=Lus10000215 locus=Lus10000215.g ID=Lus10000215.BGIv1.0 annot-version=v1.0
MIDTISCNRSYRKGFFVIFFLEQVSVGTLLAFTAVAVSVLILRYVPPDVVPVPSSLHGTIDVSPLLLGDDDVEEVKFFDHGKALHHSEGTSVSKSLGHKP
IVQVGGGLLLCGSVVLACIAQDNGRHSFGHTGGFTCPLVPYLPVACILGRDMAPRVAMATDRGAYLRVLWSESQLSDRCRLCSYCSCKEGTLRFVVAIMK
TNPSSGPRLEL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G58030 CAT2 cationic amino acid transporte... Lus10000215 0 1
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10011985 5.1 0.9050
AT1G12520 ATCCS, CCS1 copper chaperone for SOD1 (.1.... Lus10006686 11.5 0.8981
AT2G39840 TOPP4 type one serine/threonine prot... Lus10004692 19.6 0.8829
AT5G57700 BNR/Asp-box repeat family prot... Lus10008903 20.8 0.8980
AT1G68300 Adenine nucleotide alpha hydro... Lus10041436 32.9 0.8945
AT3G28050 nodulin MtN21 /EamA-like trans... Lus10010695 33.6 0.8935
AT5G05320 FAD/NAD(P)-binding oxidoreduct... Lus10034468 33.8 0.8920
AT2G02390 GST18, ATGSTZ1 GLUTATHIONE S-TRANSFERASE 18, ... Lus10030274 37.5 0.8774
AT4G38980 unknown protein Lus10035474 38.5 0.8677
AT3G55960 Haloacid dehalogenase-like hyd... Lus10002484 41.4 0.8926

Lus10000215 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.