Lus10000223 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G10750 143 / 2e-42 Phosphoenolpyruvate carboxylase family protein (.1)
AT4G24080 122 / 2e-35 ALL1 aldolase like (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017323 145 / 7e-43 AT4G10750 440 / 7e-155 Phosphoenolpyruvate carboxylase family protein (.1)
Lus10000224 135 / 2e-39 AT4G10750 409 / 3e-143 Phosphoenolpyruvate carboxylase family protein (.1)
Lus10003220 73 / 7e-18 AT4G10750 93 / 5e-24 Phosphoenolpyruvate carboxylase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G145700 146 / 1e-43 AT4G10750 435 / 2e-153 Phosphoenolpyruvate carboxylase family protein (.1)
Potri.001G084900 125 / 8e-37 AT4G10750 211 / 3e-08 Phosphoenolpyruvate carboxylase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0151 PK_TIM PF03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family
Representative CDS sequence
>Lus10000223 pacid=23174754 polypeptide=Lus10000223 locus=Lus10000223.g ID=Lus10000223.BGIv1.0 annot-version=v1.0
ATGTTCCCGCTAATCCACGACCCGGAATCCGCCAAGAAAGCAGTCTCTTACTGCTGCTACCCTCCCGCAGGGACACGTGGCGCCGCACACCCGGTGATCA
GAGCGTCGAAATACGGCCTCGACGACGACTACGTGGCCAACAGCGACAGGGATCTATTTATAATCTGCCAGGTGGAATCGGTGGAGGCAGTGAATAGAAC
CGGAGTGATCACAGCAGTCGACGGTGTCGACTGTTTGATGGTGGGTCCGTTGGACTTGAGCGCGGACATGGGCTATTTAAACGACCCGGGACAGCAGAAA
GTGAAGGAGATGATAAGCGAGGCCGAGGAGGCTGTGTTGGGCCGGATTAGAAGTAAAGGTTTCGGGATCTATTTGCGATGGGGAAAGATGGGCTTGGGCC
GGAGGAGCTGA
AA sequence
>Lus10000223 pacid=23174754 polypeptide=Lus10000223 locus=Lus10000223.g ID=Lus10000223.BGIv1.0 annot-version=v1.0
MFPLIHDPESAKKAVSYCCYPPAGTRGAAHPVIRASKYGLDDDYVANSDRDLFIICQVESVEAVNRTGVITAVDGVDCLMVGPLDLSADMGYLNDPGQQK
VKEMISEAEEAVLGRIRSKGFGIYLRWGKMGLGRRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G10750 Phosphoenolpyruvate carboxylas... Lus10000223 0 1
AT2G24450 FLA3 FASCICLIN-like arabinogalactan... Lus10026957 1.7 0.7828
AT3G14760 unknown protein Lus10042496 5.2 0.7407
AT1G21150 Mitochondrial transcription te... Lus10016552 15.3 0.6487
AT2G27610 Tetratricopeptide repeat (TPR)... Lus10020588 18.0 0.6358
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10024910 19.4 0.7700
AT1G57610 Protein of unknown function (D... Lus10019127 22.8 0.7044
AT1G61560 ATMLO6, MLO6 MILDEW RESISTANCE LOCUS O 6, S... Lus10036120 25.6 0.7332
Lus10034718 31.8 0.7326
AT3G47570 Leucine-rich repeat protein ki... Lus10030636 35.3 0.7295
AT2G04865 Aminotransferase-like, plant m... Lus10003728 36.2 0.7055

Lus10000223 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.