Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02440 44 / 2e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023770 [exp] 144 / 2e-45 AT5G02440 97 / 2e-25 unknown protein Lus10025345 [exp] 54 / 4e-10 AT5G02440 67 / 6e-14 unknown protein Lus10024400 [exp] 54 / 7e-10 AT5G02440 88 / 1e-21 unknown protein Lus10016560 [exp] 41 / 3e-05 AT5G02440 66 / 2e-13 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G084400 [exp] 49 / 5e-08 AT5G02440 78 / 5e-18 unknown protein Potri.009G030100 [exp] 44 / 3e-06 AT5G02440 98 / 1e-25 unknown protein Potri.001G238900 [exp] 41 / 2e-05 AT5G02440 81 / 4e-19 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000246 pacid=23158693 polypeptide=Lus10000246 locus=Lus10000246.g ID=Lus10000246.BGIv1.0 annot-version=v1.0 ATGAGGGGGAGAGCAGGAAGCAGGTCAGAGAGTTTTGCAAGAGATCAAGGGCAACATAGGAAGCCAAAACCATGGATATTCTCATTATGCTCCAGGCTGA CCACTGATGCAGTTGATAGAAGATCATCATCATCATCGTCATCTTCCATGAGCAATCCTCCTCCTTCTCTTGGCCACTTCCTTGAAGTAGAGAGAAGAGC TTCTTCCGCTACCAATGGCAACGCCAAATTGTTGGAGCAGGAGGAAAGTAATGGATATGCATCCTCATTAGTGCTTTCCTCATGTCTATGTATTGGATAG
AA sequence Show only first row Show all	>Lus10000246 pacid=23158693 polypeptide=Lus10000246 locus=Lus10000246.g ID=Lus10000246.BGIv1.0 annot-version=v1.0 MRGRAGSRSESFARDQGQHRKPKPWIFSLCSRLTTDAVDRRSSSSSSSSMSNPPPSLGHFLEVERRASSATNGNAKLLEQEESNGYASSLVLSSCLCIG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02440			unknown protein		Lus10000246 [exp]	0	1
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10041961 [exp]	3.3	0.7748
AT3G44716			unknown protein		Lus10009406 [exp]	10.6	0.7196
					Lus10022623 [exp]	16.3	0.7059
AT4G27590			Heavy metal transport/detoxifi...		Lus10032924 [exp]	18.8	0.7064
AT2G01940	C2H2ZnF	SGR5, ATIDD15	SHOOT GRAVITROPISM 5, ARABIDOP...		Lus10026369 [exp]	27.1	0.6805
AT4G11880	MADS	AGL14	AGAMOUS-like 14 (.1)		Lus10006716 [exp]	27.6	0.7255
AT1G24625	C2H2ZnF	ZFP7	zinc finger protein 7 (.1)		Lus10003681 [exp]	35.1	0.7004
AT5G62670		AHA11	H\(+\)-ATPase 11, H\(+\)-ATPas...		Lus10003259 [exp]	35.3	0.6742
AT1G49480	B3	REM19, RTV1	related to vernalization1 1 (....		Lus10009214 [exp]	41.2	0.6824
AT3G14880			unknown protein		Lus10039193 [exp]	42.7	0.6913

Compare expression of checked genes

Lus10000246 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.