Lus10000247 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20710 85 / 1e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT1G60770 77 / 2e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G02150 75 / 1e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G02820 73 / 3e-15 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G27460 67 / 4e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G21705 57 / 1e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G02370 56 / 3e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G01990 49 / 5e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G12775 47 / 4e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G09820 46 / 6e-06 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029313 343 / 2e-119 AT2G20710 127 / 2e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10005600 233 / 1e-79 AT2G20710 91 / 2e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10016229 114 / 5e-30 AT2G20710 269 / 7e-86 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10000091 89 / 6e-21 AT4G21705 426 / 8e-147 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10005855 89 / 9e-21 AT4G21705 503 / 5e-176 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10003590 86 / 1e-19 AT4G21705 434 / 2e-148 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10001213 85 / 3e-19 AT4G21705 500 / 2e-174 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10008724 76 / 3e-16 AT5G27460 492 / 6e-171 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10033698 67 / 3e-13 AT2G20710 349 / 4e-115 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G063300 125 / 5e-34 AT2G20710 345 / 1e-113 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.011G051700 114 / 2e-31 AT2G20710 151 / 1e-43 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.016G063400 114 / 1e-29 AT2G20710 349 / 3e-115 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.013G132500 104 / 2e-26 AT2G20710 388 / 4e-131 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.013G133000 104 / 3e-26 AT2G20710 310 / 1e-100 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.013G132700 96 / 5e-23 AT2G20710 387 / 2e-130 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.004G042500 91 / 3e-21 AT4G21705 608 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.011G051500 87 / 5e-20 AT4G21705 605 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.014G050300 84 / 7e-19 AT1G02150 698 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.011G120900 83 / 1e-18 AT4G21705 483 / 8e-168 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10000247 pacid=23157499 polypeptide=Lus10000247 locus=Lus10000247.g ID=Lus10000247.BGIv1.0 annot-version=v1.0
ATGGGGAAGAAAGATGAAGTCTTTGCAGTTTGGGAACGTCTAAAGAAGAGCGGGAAGAAGGTTCTCAAGAAAGGGTACATGGACTTGATATCTTCCCTCA
CAAAGCTGGGCGATTTCGAGGCTGCTGAGAAGATACTCGACAAGTGGGAGTCTCGGGAGAGCCCTGGTTACGATGTCCGCATCCCTAACGTCCTCGTCAG
CGCCTACATGAAAGTTGGTCGTTTGGAAGAAGTCGGGGCCGTCGTGGAGAGGACGAGATCGAAAGGCGTCCAGCCACACGCAAACTCATGGCTTTCGTTG
GCGGTAGGGTATCTCGAGCATCGTAAGGATGTGTTGAAGGCGGTGGAGGCGATGAAGAGAGGCGTAACGGTGTCGGAGTCAGGTTGGAAACCCGACCCGA
GAGGGTTGGCCGAGTGTCTGCAGCAGTTGAAAGATGCTGGGGGAGATCGTTTGGAGGAAGCGCGAGAGCTTGTGCAATTGCTGATGGAGCAGAATGTTGT
TCCTTTAGCTGTTGGAAAGAAATGGTTGGTGGATGGTTCATCTGATCGGGTTGAAGAATCGGCTGAGTGA
AA sequence
>Lus10000247 pacid=23157499 polypeptide=Lus10000247 locus=Lus10000247.g ID=Lus10000247.BGIv1.0 annot-version=v1.0
MGKKDEVFAVWERLKKSGKKVLKKGYMDLISSLTKLGDFEAAEKILDKWESRESPGYDVRIPNVLVSAYMKVGRLEEVGAVVERTRSKGVQPHANSWLSL
AVGYLEHRKDVLKAVEAMKRGVTVSESGWKPDPRGLAECLQQLKDAGGDRLEEARELVQLLMEQNVVPLAVGKKWLVDGSSDRVEESAE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G20710 Tetratricopeptide repeat (TPR)... Lus10000247 0 1
AT1G63060 unknown protein Lus10000001 15.7
AT5G26150 protein kinase family protein ... Lus10000068 129.3
AT5G35110 unknown protein Lus10000078 138.5
AT2G38540 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRA... Lus10000082 142.0
AT2G46490 unknown protein Lus10000088 147.1
AT4G09160 SEC14 cytosolic factor family ... Lus10000102 158.4
AT1G60780 HAP13 HAPLESS 13, Clathrin adaptor c... Lus10000107 162.2
Lus10000109 163.7
AT3G07565 Protein of unknown function (D... Lus10000123 173.9
Lus10000134 181.6

Lus10000247 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.