Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G29130 162 / 9e-53 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023356 [exp] 262 / 4e-92 AT3G29130 162 / 9e-53 unknown protein Lus10038450 [exp] 249 / 5e-87 AT3G29130 165 / 7e-54 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G098200 [exp] 176 / 3e-58 AT3G29130 142 / 4e-45 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10241 [flax] [poplar] KxDL Uncharacterized conserved protein
Representative CDS sequence Show only first row Show all	>Lus10000252 pacid=23163522 polypeptide=Lus10000252 locus=Lus10000252.g ID=Lus10000252.BGIv1.0 annot-version=v1.0 ATGGAGCGAACTGAGGAGAAGGAATCCATAGCAGATGCTTCCAAGGAGATTTCTCGAGAATTCAAAACCCTGATCGACGGCGAAGAATTGGATACCCTCA AGCAATCCCAGCATCTCATATTGGGAAGGTGGCAGGACAGCAATGCAGTCCTGTCTCATTTTAACGATTACTCGGAAAACTGCTTCACGGAGGTTTCCGG TGATTTTTACAAGAACACTCGACTGCTGAAGTCTATGAAGGCTGATCTTGATTACATATTTTTGAAGCTTAGAACTATGAAATCTAAAATCTCAGCTGTT TATCCTGATGCATTTACAGACGAATCAGGGAAACAAGTAGAGGATAGAAGACCGAACCTTGAAGCACCTATGGAACCCTAG
AA sequence Show only first row Show all	>Lus10000252 pacid=23163522 polypeptide=Lus10000252 locus=Lus10000252.g ID=Lus10000252.BGIv1.0 annot-version=v1.0 MERTEEKESIADASKEISREFKTLIDGEELDTLKQSQHLILGRWQDSNAVLSHFNDYSENCFTEVSGDFYKNTRLLKSMKADLDYIFLKLRTMKSKISAV YPDAFTDESGKQVEDRRPNLEAPMEP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G29130			unknown protein		Lus10000252 [exp]	0	1
AT3G15580		APG8H, ATG8I	AUTOPHAGY 8I, AUTOPHAGY 8H, Ub...		Lus10038046 [exp]	2.0	0.8119
AT1G50670			OTU-like cysteine protease fam...		Lus10040075 [exp]	12.6	0.7811
AT2G23090			Uncharacterised protein family...		Lus10011535 [exp]	16.2	0.7749
AT5G17060		ATARFB1B	ADP-ribosylation factor B1B (....		Lus10020392 [exp]	20.0	0.7656
AT3G29280			unknown protein		Lus10018197 [exp]	21.8	0.7406
AT2G17350			unknown protein		Lus10022984 [exp]	25.4	0.7318
AT5G41560			unknown protein		Lus10017523 [exp]	29.5	0.7584
AT4G20330			Transcription initiation facto...		Lus10029563 [exp]	32.7	0.7694
AT2G18050		HIS1-3	histone H1-3 (.1.2)		Lus10014267 [exp]	33.8	0.7552
AT5G64460			Phosphoglycerate mutase family...		Lus10020467 [exp]	39.3	0.7112

Compare expression of checked genes

Lus10000252 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.