Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G26670 139 / 1e-41 Pectinacetylesterase family protein (.1.2) AT3G05910 138 / 2e-40 Pectinacetylesterase family protein (.1.2) AT1G57590 133 / 2e-38 Pectinacetylesterase family protein (.1) AT3G62060 122 / 2e-34 Pectinacetylesterase family protein (.1) AT2G46930 116 / 5e-32 Pectinacetylesterase family protein (.1) AT1G09550 90 / 3e-22 Pectinacetylesterase family protein (.1) AT3G09410 88 / 1e-21 Pectinacetylesterase family protein (.1.3) AT5G23870 86 / 1e-20 Pectinacetylesterase family protein (.1.2.3) AT4G19420 81 / 4e-19 Pectinacetylesterase family protein (.1.2) AT5G45280 75 / 6e-17 Pectinacetylesterase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038024 [exp] 133 / 3e-38 AT3G62060 610 / 0.0 Pectinacetylesterase family protein (.1) Lus10009966 [exp] 132 / 1e-37 AT3G62060 613 / 0.0 Pectinacetylesterase family protein (.1) Lus10010084 [exp] 127 / 2e-36 AT5G26670 491 / 9e-174 Pectinacetylesterase family protein (.1.2) Lus10007200 [exp] 128 / 3e-36 AT3G62060 585 / 0.0 Pectinacetylesterase family protein (.1) Lus10039238 [exp] 94 / 1e-23 AT5G23870 513 / 0.0 Pectinacetylesterase family protein (.1.2.3) Lus10037269 [exp] 89 / 2e-21 AT4G19420 548 / 0.0 Pectinacetylesterase family protein (.1.2) Lus10034766 [exp] 87 / 3e-21 AT4G19420 508 / 0.0 Pectinacetylesterase family protein (.1.2) Lus10033305 [exp] 87 / 5e-21 AT4G19420 572 / 0.0 Pectinacetylesterase family protein (.1.2) Lus10034767 [exp] 86 / 1e-20 AT4G19420 574 / 0.0 Pectinacetylesterase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G001500 [exp] 142 / 6e-42 AT3G05910 602 / 0.0 Pectinacetylesterase family protein (.1.2) Potri.013G000900 [exp] 139 / 1e-40 AT3G05910 629 / 0.0 Pectinacetylesterase family protein (.1.2) Potri.010G004400 [exp] 135 / 7e-39 AT5G26670 559 / 0.0 Pectinacetylesterase family protein (.1.2) Potri.014G110900 [exp] 127 / 7e-36 AT3G62060 611 / 0.0 Pectinacetylesterase family protein (.1) Potri.006G084900 [exp] 100 / 7e-26 AT3G09410 570 / 0.0 Pectinacetylesterase family protein (.1.3) Potri.012G142300 [exp] 99 / 1e-25 AT5G23870 511 / 0.0 Pectinacetylesterase family protein (.1.2.3) Potri.015G145400 [exp] 95 / 3e-24 AT5G23870 509 / 0.0 Pectinacetylesterase family protein (.1.2.3) Potri.004G234100 [exp] 84 / 7e-20 AT4G19420 597 / 0.0 Pectinacetylesterase family protein (.1.2) Potri.003G046200 [exp] 70 / 4e-15 AT5G45280 541 / 0.0 Pectinacetylesterase family protein (.1.2) Potri.004G233900 [exp] 66 / 2e-13 AT5G45280 567 / 0.0 Pectinacetylesterase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [flax] [poplar] AB_hydrolase PF03283 [flax] [poplar] PAE Pectinacetylesterase
Representative CDS sequence Show only first row Show all	>Lus10000253 pacid=23162267 polypeptide=Lus10000253 locus=Lus10000253.g ID=Lus10000253.BGIv1.0 annot-version=v1.0 ATGTTGTTTTGGTTGAGTCAGATCCAGTCCAGTTTAGCTCCACCGTCTGCAGATCCCCAGGGCTACTGGAGTGGATGTAAAAAGAACCATGCAAAATGTA CTCCGTCACAGATCCAGTTTCTACAAGGATTCAGAAACCGAATGCTGAATATCGTTAGAAGATTTTCCATGTTTAAGAAGAACGGATTGTTCATAAATTC GTGTTTTGCACACTGCCAAACAGAGAGACAAGATACTTGGTTCGCTAAGGGTTCTCCCACCATCAGAAATAAGGTAATTATTACTTTTTTTTGTCTATTT TCTTTCTCCACCAATCTTAGTATCTTATCTGAACTATTAATCATCTATTATCTGTCTAGTTTGTAA
AA sequence Show only first row Show all	>Lus10000253 pacid=23162267 polypeptide=Lus10000253 locus=Lus10000253.g ID=Lus10000253.BGIv1.0 annot-version=v1.0 MLFWLSQIQSSLAPPSADPQGYWSGCKKNHAKCTPSQIQFLQGFRNRMLNIVRRFSMFKKNGLFINSCFAHCQTERQDTWFAKGSPTIRNKVIITFFCLF SFSTNLSILSELLIIYYLSSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G26670			Pectinacetylesterase family pr...		Lus10000253 [exp]	0	1
AT1G26480		GF14IOTA, GRF12	general regulatory factor 12 (...		Lus10036471 [exp]	5.3	0.8833
AT3G19800			Protein of unknown function (D...		Lus10040969 [exp]	5.8	0.8890
AT5G57170			Tautomerase/MIF superfamily pr...		Lus10034783 [exp]	6.3	0.8614
AT2G21370		XK1, XK-1	XYLULOSE KINASE 1, xylulose ki...		Lus10017967 [exp]	7.9	0.8823
AT3G52950			CBS / octicosapeptide/Phox/Bem...		Lus10035965 [exp]	8.8	0.8359
AT5G01030			Protein of unknown function (D...		Lus10017200 [exp]	9.2	0.8717
					Lus10001769 [exp]	11.6	0.8727
AT1G18040		CDKD1;3, AT;CDC...	cyclin-dependent kinase D1;3 (...		Lus10001184 [exp]	13.6	0.8237
AT1G54350		ABCD2	ATP-binding cassette D2, ABC t...		Lus10001839 [exp]	18.9	0.8705
AT3G15354		SPA3	SPA1-related 3 (.1)		Lus10019475 [exp]	19.1	0.8778

Compare expression of checked genes

Lus10000253 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.