Lus10000255 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G61620 258 / 2e-88 RRP41 3'-5'-exoribonuclease family protein (.1.2)
AT4G27490 58 / 1e-10 3'-5'-exoribonuclease family protein (.1)
AT3G46210 50 / 9e-08 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3.4.5.6)
AT5G14580 43 / 6e-05 polyribonucleotide nucleotidyltransferase, putative (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005148 287 / 4e-99 AT3G61620 376 / 4e-133 3'-5'-exoribonuclease family protein (.1.2)
Lus10003036 284 / 6e-98 AT3G61620 370 / 9e-131 3'-5'-exoribonuclease family protein (.1.2)
Lus10037395 67 / 1e-13 AT4G27490 409 / 2e-146 3'-5'-exoribonuclease family protein (.1)
Lus10041318 65 / 6e-13 AT4G27490 414 / 4e-148 3'-5'-exoribonuclease family protein (.1)
Lus10009221 47 / 1e-06 AT3G46210 387 / 4e-138 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3.4.5.6)
Lus10008763 45 / 9e-06 AT5G14580 1215 / 0.0 polyribonucleotide nucleotidyltransferase, putative (.1)
Lus10022250 45 / 9e-06 AT5G14580 1244 / 0.0 polyribonucleotide nucleotidyltransferase, putative (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G094300 291 / 2e-101 AT3G61620 379 / 6e-135 3'-5'-exoribonuclease family protein (.1.2)
Potri.004G212500 66 / 4e-13 AT4G27490 392 / 2e-139 3'-5'-exoribonuclease family protein (.1)
Potri.009G010600 62 / 4e-12 AT4G27490 394 / 3e-140 3'-5'-exoribonuclease family protein (.1)
Potri.018G043600 48 / 6e-07 AT3G46210 404 / 2e-144 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3.4.5.6)
Potri.006G239100 42 / 6e-05 AT3G46210 295 / 4e-102 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3.4.5.6)
Potri.001G347900 40 / 0.0003 AT5G14580 1224 / 0.0 polyribonucleotide nucleotidyltransferase, putative (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0329 S5 PF01138 RNase_PH 3' exoribonuclease family, domain 1
CL0329 PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Representative CDS sequence
>Lus10000255 pacid=23174876 polypeptide=Lus10000255 locus=Lus10000255.g ID=Lus10000255.BGIv1.0 annot-version=v1.0
ATGGCTAATTTCAGTACTGGTGACCGCAAGCGAAAACCCAAGGGAGATAGGCGATCAACAGAGATATCTTTAGTTATCCGTCAGACTATGGAAGCCTGCA
TATTGACTCACTTAATGCCCCGTTCTCAGATAGATATCTATGTCCAAGTTCTTCAAGCTGATGGAGGAACTAGATCTGCATGTATAAATGCTGCTGTATT
GGCCCTAGCTGATGCCGGGATCCCAATGTCTGACCTTGTGACTTCCTGCAGTGCTGGTTACCTCAACAGCACTCCTCTGCTCGATCTGAATTATCTTGAA
GATAGTGCTGGAGGTCCTGATGTTACCGTCGGTATTCTACCAACGCTAGACAAAGTCACCCTTCTTCAGATGGACGCCAAGTTACCAGTTGATATCTTTG
AAAACGTTATGCAACTGGCAACCGAAGGCTGCAAGGCGATAGCAACTTACATACGTGAGATATTGCTTGAGAACACCAAGCAACTAGAGTATCGACGGGG
CATATGA
AA sequence
>Lus10000255 pacid=23174876 polypeptide=Lus10000255 locus=Lus10000255.g ID=Lus10000255.BGIv1.0 annot-version=v1.0
MANFSTGDRKRKPKGDRRSTEISLVIRQTMEACILTHLMPRSQIDIYVQVLQADGGTRSACINAAVLALADAGIPMSDLVTSCSAGYLNSTPLLDLNYLE
DSAGGPDVTVGILPTLDKVTLLQMDAKLPVDIFENVMQLATEGCKAIATYIREILLENTKQLEYRRGI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G61620 RRP41 3'-5'-exoribonuclease family p... Lus10000255 0 1
AT1G64350 SEH1H Transducin/WD40 repeat-like su... Lus10001904 3.5 0.8617
AT4G16720 Ribosomal protein L23/L15e fam... Lus10009653 4.2 0.8634
AT3G61620 RRP41 3'-5'-exoribonuclease family p... Lus10005148 4.5 0.8329
AT1G64350 SEH1H Transducin/WD40 repeat-like su... Lus10003896 5.7 0.8474
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Lus10010745 6.9 0.8498
AT3G55010 EMB2818, ATPURM... EMBRYO DEFECTIVE 2818, phospho... Lus10040931 8.8 0.8285
AT1G47720 OSB1 Organellar Single-stranded, Pr... Lus10014728 9.5 0.8220
AT1G60660 B5 #5, B5#5, AT... ARABIDOPSIS CYTOCHROME B5-LIKE... Lus10012954 11.0 0.8112
AT2G04560 AtLpxB lipid X B, transferases, trans... Lus10029959 12.2 0.8009
AT4G09800 RPS18C S18 ribosomal protein (.1) Lus10006914 12.6 0.8448

Lus10000255 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.