Plant FIBer expression Database

Lus10000261 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G12646 40 / 5e-05 PLATZ transcription factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038103
[exp]
157 / 2e-49 AT2G12646 289 / 1e-98 PLATZ transcription factor family protein (.1)
Lus10008031
[exp]
123 / 5e-36 AT2G12646 294 / 1e-100 PLATZ transcription factor family protein (.1)
Lus10008814
[exp]
71 / 9e-16 AT2G12646 301 / 4e-103 PLATZ transcription factor family protein (.1)
Lus10039989
[exp]
68 / 1e-14 AT2G12646 292 / 3e-99 PLATZ transcription factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G116000
[exp]
59 / 6e-12 AT2G12646 318 / 2e-110 PLATZ transcription factor family protein (.1)
Potri.006G060500
[exp]
56 / 2e-10 AT2G12646 321 / 1e-111 PLATZ transcription factor family protein (.1)
PFAM info
Representative CDS sequence
>Lus10000261 pacid=23149791 polypeptide=Lus10000261 locus=Lus10000261.g ID=Lus10000261.BGIv1.0 annot-version=v1.0
ATGACGGCGACCAACCATTCCACAATTGTGGACTCTGACGAGCCAATGAGCTGGTTGTCAGGATCTCGTTTTGGCTCCTCTTCCTCCTCCTCTAATTCAT
CAGGATATATGAACAACATGATTGCAGCTTGTACGAACAAAGTTGTAGGAAAGAAGAGAACCGGGTTGGTCTACGTTTGGTCGACGAGCAATTATGATGA
TCATGATCATAATAGTAGTACAGTCTCCGACGAGGGCATGGCCACAAGCATGAGTCGAAGGAAAGGCGTTCCTCAACGCTCACCTATGTGTTAA
AA sequence
>Lus10000261 pacid=23149791 polypeptide=Lus10000261 locus=Lus10000261.g ID=Lus10000261.BGIv1.0 annot-version=v1.0
MTATNHSTIVDSDEPMSWLSGSRFGSSSSSSNSSGYMNNMIAACTNKVVGKKRTGLVYVWSTSNYDDHDHNSSTVSDEGMATSMSRRKGVPQRSPMC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G12646 PLATZ transcription factor fam... Lus10000261
[exp]
0 1
AT1G52800 2-oxoglutarate (2OG) and Fe(II... Lus10005775
[exp]
12.6 0.7064
AT1G49320 ATUSPL1 unknown seed protein like 1 (.... Lus10032324
[exp]
20.8 0.6907
AT1G60830 RNA-binding (RRM/RBD/RNP motif... Lus10011201
[exp]
27.7 0.6479
AT1G52790 2-oxoglutarate (2OG) and Fe(II... Lus10005776
[exp]
52.9 0.6018
AT4G16566 HINT4 histidine triad nucleotide-bin... Lus10007467
[exp]
55.7 0.6006
AT3G26720 Glycosyl hydrolase family 38 p... Lus10014259
[exp]
71.4 0.5975
AT2G19070 SHT spermidine hydroxycinnamoyl tr... Lus10021393
[exp]
118.4 0.5365
AT3G19850 Phototropic-responsive NPH3 fa... Lus10029070
[exp]
126.1 0.5367
Lus10012943
[exp]
172.0 0.5620
AT4G34135 UGT73B2 UDP-glucosyltransferase 73B2 (... Lus10010240
[exp]
196.1 0.5400

Lus10000261 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.