Lus10000269 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26670 82 / 9e-19 Pectinacetylesterase family protein (.1.2)
AT3G05910 79 / 6e-18 Pectinacetylesterase family protein (.1.2)
AT1G57590 79 / 8e-18 Pectinacetylesterase family protein (.1)
AT1G09550 77 / 7e-17 Pectinacetylesterase family protein (.1)
AT2G46930 74 / 7e-16 Pectinacetylesterase family protein (.1)
AT3G62060 70 / 2e-14 Pectinacetylesterase family protein (.1)
AT5G23870 61 / 2e-11 Pectinacetylesterase family protein (.1.2.3)
AT3G09410 60 / 5e-11 Pectinacetylesterase family protein (.1.3)
AT3G09405 60 / 6e-11 Pectinacetylesterase family protein (.1)
AT4G19420 59 / 2e-10 Pectinacetylesterase family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038024 76 / 2e-16 AT3G62060 610 / 0.0 Pectinacetylesterase family protein (.1)
Lus10007200 74 / 5e-16 AT3G62060 585 / 0.0 Pectinacetylesterase family protein (.1)
Lus10009966 74 / 7e-16 AT3G62060 613 / 0.0 Pectinacetylesterase family protein (.1)
Lus10010084 73 / 2e-15 AT5G26670 491 / 9e-174 Pectinacetylesterase family protein (.1.2)
Lus10039238 63 / 4e-12 AT5G23870 513 / 0.0 Pectinacetylesterase family protein (.1.2.3)
Lus10025347 54 / 5e-09 AT3G09410 250 / 8e-81 Pectinacetylesterase family protein (.1.3)
Lus10033304 54 / 9e-09 AT4G19420 392 / 2e-134 Pectinacetylesterase family protein (.1.2)
Lus10024398 53 / 1e-08 AT3G09410 553 / 0.0 Pectinacetylesterase family protein (.1.3)
Lus10034766 53 / 2e-08 AT4G19420 508 / 0.0 Pectinacetylesterase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G004400 88 / 7e-21 AT5G26670 559 / 0.0 Pectinacetylesterase family protein (.1.2)
Potri.013G000900 86 / 5e-20 AT3G05910 629 / 0.0 Pectinacetylesterase family protein (.1.2)
Potri.005G001500 83 / 4e-19 AT3G05910 602 / 0.0 Pectinacetylesterase family protein (.1.2)
Potri.014G110900 73 / 1e-15 AT3G62060 611 / 0.0 Pectinacetylesterase family protein (.1)
Potri.015G145400 66 / 5e-13 AT5G23870 509 / 0.0 Pectinacetylesterase family protein (.1.2.3)
Potri.012G142300 64 / 2e-12 AT5G23870 511 / 0.0 Pectinacetylesterase family protein (.1.2.3)
Potri.006G084900 62 / 1e-11 AT3G09410 570 / 0.0 Pectinacetylesterase family protein (.1.3)
Potri.004G234100 56 / 2e-09 AT4G19420 597 / 0.0 Pectinacetylesterase family protein (.1.2)
Potri.003G046200 54 / 6e-09 AT5G45280 541 / 0.0 Pectinacetylesterase family protein (.1.2)
Potri.004G233900 51 / 4e-08 AT5G45280 567 / 0.0 Pectinacetylesterase family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0028 AB_hydrolase PF03283 PAE Pectinacetylesterase
Representative CDS sequence
>Lus10000269 pacid=23148774 polypeptide=Lus10000269 locus=Lus10000269.g ID=Lus10000269.BGIv1.0 annot-version=v1.0
ATGATGAGCAAGCAGCTTTTGTTGTTGATACTGTTGGTCCTGGTATCCGGTGCGGTGGTCATCGGGATGACTGCAGATGGATGGTTTCCAGAAGAAGCTG
AGGAAACATTATTCTACACCAGTAGTAGTAATAGCGGTACTAGTAATGACTTCTTCTATTACGAATTTCTCAATAATACTAATCATGAATCGAGGGCCAA
TTTTAGACATGCTTCTCCTCCATTGATGGTGGGTCTCACCCTCATCCCTGCAGCTGCGGAAACAAGAGCAGTTTGTTTGGATGGATCCTTGCCTGGCTAT
CATTTGCACCGCGGATATGGTTCCGGAGCAAATAGTTGGCTCATCCAACTGGAGGTACGGCATCTGCATTCCTTATTCTACAATGATTTCTTGATGTTGT
TGTTGTGCTTCTTAACGAAACTGCAAAATGATCCACCTGTGGATAAAAAGATCCTTGGAGTATATGGCCTTGTTGAGAAGTGA
AA sequence
>Lus10000269 pacid=23148774 polypeptide=Lus10000269 locus=Lus10000269.g ID=Lus10000269.BGIv1.0 annot-version=v1.0
MMSKQLLLLILLVLVSGAVVIGMTADGWFPEEAEETLFYTSSSNSGTSNDFFYYEFLNNTNHESRANFRHASPPLMVGLTLIPAAAETRAVCLDGSLPGY
HLHRGYGSGANSWLIQLEVRHLHSLFYNDFLMLLLCFLTKLQNDPPVDKKILGVYGLVEK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G26670 Pectinacetylesterase family pr... Lus10000269 0 1
AT1G71810 Protein kinase superfamily pro... Lus10017924 2.0 0.9130
AT1G73990 SPPA1, SPPA signal peptide peptidase (.1) Lus10021721 2.8 0.9099
AT4G32140 EamA-like transporter family (... Lus10042422 4.0 0.8972
AT5G51290 Diacylglycerol kinase family p... Lus10016714 7.0 0.8847
AT1G32080 AtLrgB membrane protein, putative (.1... Lus10012137 8.1 0.9011
AT2G38330 MATE efflux family protein (.1... Lus10002856 9.4 0.8712
AT5G64860 DPE1 disproportionating enzyme (.1) Lus10035845 9.7 0.8327
AT1G73990 SPPA1, SPPA signal peptide peptidase (.1) Lus10034647 11.8 0.8512
AT5G22830 MRS2-11, GMN10,... MAGNESIUM TRANSPORTER 10, magn... Lus10005365 12.2 0.8944
AT3G15354 SPA3 SPA1-related 3 (.1) Lus10019476 12.2 0.8951

Lus10000269 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.