Lus10000273 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034814 223 / 4e-77 ND /
Lus10033364 97 / 2e-24 AT4G38540 84 / 4e-34 FAD/NAD(P)-binding oxidoreductase family protein (.1)
Lus10011254 83 / 8e-20 AT1G61330 84 / 6e-17 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
Lus10018433 71 / 1e-15 AT1G61330 109 / 2e-25 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
Lus10042721 71 / 2e-15 AT1G21750 684 / 0.0 ARABIDOPSIS THALIANA PROTEIN DISULFIDE ISOMERASE 5, PDI-like 1-1 (.1.2)
Lus10029682 61 / 2e-13 ND /
Lus10010664 63 / 1e-12 AT1G61320 125 / 6e-31 FBD / Leucine Rich Repeat domains containing protein (.1)
Lus10011971 61 / 5e-12 AT1G61320 103 / 2e-23 FBD / Leucine Rich Repeat domains containing protein (.1)
Lus10034733 61 / 1e-11 AT1G61320 110 / 5e-26 FBD / Leucine Rich Repeat domains containing protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10000273 pacid=23163250 polypeptide=Lus10000273 locus=Lus10000273.g ID=Lus10000273.BGIv1.0 annot-version=v1.0
ATGGAGTATGCTCCCAAACGCACTCAAATAGGAGCATCTAGTTCCATAGCCAAGGAGAAAGCCAACAAACACACTAAATGGAAGGACTTATTGACATTCT
CGAACGATATACTCACGGAAGGAGATCAGACAACTAGTACAGTTCAATACCGCAGCCAAGCAGTTGAGGGTGACATCCGACCTCCTATTCCAATCAAGAC
CCTTGAGACCCTTCGCCTGGTGTATGTTGATATAGGGTCGCCAAACAATGATTTCTCTATCACCGGGCTTAGATTTCTCAAAATCTACTCAATGAAGAAG
GCGAGTATCAAACTAATCATCCTCAATGTCTAG
AA sequence
>Lus10000273 pacid=23163250 polypeptide=Lus10000273 locus=Lus10000273.g ID=Lus10000273.BGIv1.0 annot-version=v1.0
MEYAPKRTQIGASSSIAKEKANKHTKWKDLLTFSNDILTEGDQTTSTVQYRSQAVEGDIRPPIPIKTLETLRLVYVDIGSPNNDFSITGLRFLKIYSMKK
ASIKLIILNV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10000273 0 1
AT1G17930 Aminotransferase-like, plant m... Lus10001981 1.0 1.0000
AT4G13420 HAK5, ATHAK5 high affinity K+ transporter 5... Lus10005194 1.4 1.0000
Lus10027667 1.7 1.0000
Lus10015682 2.0 1.0000
AT4G18340 Glycosyl hydrolase superfamily... Lus10031034 2.2 1.0000
AT2G14378 Protein of unknown function (D... Lus10019101 2.4 1.0000
AT1G29430 SAUR-like auxin-responsive pro... Lus10020431 2.6 1.0000
AT1G14290 SBH2 sphingoid base hydroxylase 2 (... Lus10036293 2.8 1.0000
Lus10040407 3.0 1.0000
AT3G20800 Cell differentiation, Rcd1-lik... Lus10015136 4.7 0.8506

Lus10000273 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.