Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G10980 229 / 3e-79 Histone superfamily protein (.1) AT4G40030 229 / 3e-79 Histone superfamily protein (.1.2.3) AT4G40040 229 / 3e-79 Histone superfamily protein (.1.2) AT1G75600 227 / 2e-78 Histone superfamily protein (.1) AT1G13370 222 / 2e-76 Histone superfamily protein (.1) AT1G09200 220 / 8e-76 Histone superfamily protein (.1) AT3G27360 220 / 8e-76 Histone superfamily protein (.1) AT5G10390 220 / 8e-76 Histone superfamily protein (.1) AT5G10400 220 / 8e-76 Histone superfamily protein (.1) AT5G65360 220 / 8e-76 Histone superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012757 [exp] 228 / 4e-79 AT4G40030 229 / 3e-79 Histone superfamily protein (.1.2.3) Lus10031821 [exp] 222 / 1e-75 AT3G27360 273 / 3e-95 Histone superfamily protein (.1) Lus10025439 [exp] 220 / 1e-75 AT5G65360 271 / 1e-95 Histone superfamily protein (.1) Lus10031250 [exp] 220 / 1e-75 AT1G09200 271 / 1e-95 Histone superfamily protein (.1) Lus10005270 [exp] 220 / 1e-75 AT1G09200 271 / 1e-95 Histone superfamily protein (.1) Lus10005271 [exp] 220 / 1e-75 AT1G09200 271 / 1e-95 Histone superfamily protein (.1) Lus10031822 [exp] 220 / 1e-75 AT5G10400 271 / 1e-95 Histone superfamily protein (.1) Lus10012744 [exp] 219 / 2e-75 AT5G65360 271 / 2e-95 Histone superfamily protein (.1) Lus10031252 [exp] 218 / 1e-74 AT3G27360 268 / 2e-94 Histone superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G072300 [exp] 229 / 3e-79 AT5G10980 274 / 1e-96 Histone superfamily protein (.1) Potri.005G235700 [exp] 229 / 3e-79 AT5G10980 274 / 1e-96 Histone superfamily protein (.1) Potri.002G100200 [exp] 229 / 3e-79 AT5G10980 274 / 1e-96 Histone superfamily protein (.1) Potri.002G026800 [exp] 229 / 3e-79 AT5G10980 274 / 1e-96 Histone superfamily protein (.1) Potri.007G014300 [exp] 229 / 3e-79 AT5G10980 274 / 1e-96 Histone superfamily protein (.1) Potri.007G096700 [exp] 229 / 3e-79 AT5G10980 274 / 1e-96 Histone superfamily protein (.1) Potri.014G096900 [exp] 220 / 8e-76 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.002G028800 [exp] 220 / 8e-76 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.003G210100 [exp] 220 / 8e-76 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.003G207852 [exp] 220 / 8e-76 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [flax] [poplar] Histone PF00125 [flax] [poplar] Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence Show only first row Show all	>Lus10000284 pacid=23157290 polypeptide=Lus10000284 locus=Lus10000284.g ID=Lus10000284.BGIv1.0 annot-version=v1.0 ATGTTATCATTCGCTGCTCGTAAGTCTGCCCCCACCACTGGTGGAGTGAAGAAGCCCCATCGTTACAGGCCTGGAACTGTTGCTCTTCGTGAAATCCGTA AGTACCAGAAGAGTACCGAACTCTTGATCCGTAAGCTGCCATTCCAGAGGCTTGTTCGTGAAATTGCTCAGGACTTCAAGACTGATCTGCGTTTCCAGAG CCATGCTGTATTGGCCTTGCAGGAGGCAGCTGAGGCCTACCTGGTTGGTCTGTTTGAGGACACCAATCTGTGTGCCATCCATGCCAAGCGCGTGACCATT ATGCCGAAAGATATCCAGTTGGCTAGGAGGATCCGTGGTGAGCGAGCTTAA
AA sequence Show only first row Show all	>Lus10000284 pacid=23157290 polypeptide=Lus10000284 locus=Lus10000284.g ID=Lus10000284.BGIv1.0 annot-version=v1.0 MLSFAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G40030			Histone superfamily protein (....		Lus10000284 [exp]	0	1
AT2G39740		HESO1	HEN1 suppressor 1, Nucleotidyl...		Lus10001012 [exp]	4.9	0.9053
AT4G28830			S-adenosyl-L-methionine-depend...		Lus10011107 [exp]	5.6	0.9082
AT5G22320			Leucine-rich repeat (LRR) fami...		Lus10005198 [exp]	8.8	0.8926
AT3G54380		AtSAC3C	yeast Sac3 homolog C, SAC3/GAN...		Lus10024110 [exp]	13.4	0.8837
AT2G21150		XCT	XAP5 CIRCADIAN TIMEKEEPER, XAP...		Lus10012170 [exp]	16.6	0.8934
AT1G72175			RING/U-box protein with domain...		Lus10020349 [exp]	16.7	0.8965
AT1G17330			Metal-dependent phosphohydrola...		Lus10040985 [exp]	16.9	0.8829
AT2G02390		GST18, ATGSTZ1	GLUTATHIONE S-TRANSFERASE 18, ...		Lus10030274 [exp]	17.6	0.8891
					Lus10024694 [exp]	17.7	0.8787
AT1G68310		AE7	AS1/2 ENHANCER7, Protein of un...		Lus10031006 [exp]	19.0	0.8917

Compare expression of checked genes

Lus10000284 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.