Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02120 63 / 9e-15 PDF2.1, LCR70 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1) AT2G02100 62 / 1e-14 LCR69, PDF2.2 low-molecular-weight cysteine-rich 69 (.1) AT1G61070 59 / 2e-13 LCR66, PDF2.4 PLANT DEFENSIN 2.4, low-molecular-weight cysteine-rich 66 (.1) AT2G02130 59 / 4e-13 PDF2.3, LCR68 low-molecular-weight cysteine-rich 68 (.1) AT5G63660 51 / 2e-10 LCR74, PDF2.5 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1) AT2G31957 49 / 4e-09 LCR75, LCR79 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 79, low-molecular-weight cysteine-rich 75 (.1) AT2G02140 45 / 1e-07 LCR72, PDF2.6 low-molecular-weight cysteine-rich 72 (.1) AT2G31953 42 / 1e-06 LCR76 low-molecular-weight cysteine-rich 76 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029546 [exp] 116 / 4e-36 AT2G02120 65 / 1e-15 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1) Lus10039622 [exp] 103 / 3e-31 AT2G02120 65 / 5e-16 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1) Lus10019226 [exp] 59 / 3e-13 AT2G02120 81 / 6e-22 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1) Lus10004290 [exp] 58 / 7e-13 AT2G02130 78 / 1e-20 low-molecular-weight cysteine-rich 68 (.1) Lus10004289 [exp] 57 / 1e-12 AT2G02130 78 / 1e-20 low-molecular-weight cysteine-rich 68 (.1) Lus10029544 [exp] 54 / 4e-11 AT2G02130 87 / 4e-24 low-molecular-weight cysteine-rich 68 (.1) Lus10019227 [exp] 0 / 1 AT2G02130 66 / 1e-15 low-molecular-weight cysteine-rich 68 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T011201 [exp] 60 / 9e-14 AT2G02130 76 / 6e-20 low-molecular-weight cysteine-rich 68 (.1) Potri.T011200 [exp] 60 / 9e-14 AT2G02130 76 / 6e-20 low-molecular-weight cysteine-rich 68 (.1) Potri.T011301 [exp] 57 / 2e-12 AT5G63660 62 / 2e-14 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1) Potri.T011300 [exp] 57 / 2e-12 AT5G63660 62 / 2e-14 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1) Potri.004G138100 [exp] 51 / 3e-10 AT5G63660 71 / 4e-18 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0054 [flax] [poplar] Knottin_1 PF00304 [flax] [poplar] Gamma-thionin Gamma-thionin family
Representative CDS sequence Show only first row Show all	>Lus10000290 pacid=23170850 polypeptide=Lus10000290 locus=Lus10000290.g ID=Lus10000290.BGIv1.0 annot-version=v1.0 ATGGAGAAGACAAGCATTTTGGGAGGTCTGCTTTTGGTGCTGATTCTCTTGCATCCTTCTCAAGTGACGGTAGGAGAAGCTGCTGGTGCAAGAAGATGTG AGTACGAGAGCAAGAGATTCAAGGGTACGTGCGAGGTTGATAAGAACTGTGCCGACGTCTGCAAACTTGAAGGCTTCCCAAGCGGTGACTGCCAGGGCTT CCGTACTGGTTGCTACTGCACCAAACCTTGCTAA
AA sequence Show only first row Show all	>Lus10000290 pacid=23170850 polypeptide=Lus10000290 locus=Lus10000290.g ID=Lus10000290.BGIv1.0 annot-version=v1.0 MEKTSILGGLLLVLILLHPSQVTVGEAAGARRCEYESKRFKGTCEVDKNCADVCKLEGFPSGDCQGFRTGCYCTKPC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02120		PDF2.1, LCR70	LOW-MOLECULAR-WEIGHT CYSTEINE-...		Lus10000290 [exp]	0	1
AT1G63060			unknown protein		Lus10000001 [exp]	17.0
AT5G26150			protein kinase family protein ...		Lus10000068 [exp]	140.2
AT5G35110			unknown protein		Lus10000078 [exp]	150.1
AT2G38540		ATLTP1, LP1	ARABIDOPSIS THALIANA LIPID TRA...		Lus10000082 [exp]	153.9
AT2G46490			unknown protein		Lus10000088 [exp]	159.5
AT4G09160			SEC14 cytosolic factor family ...		Lus10000102 [exp]	171.7
AT1G60780		HAP13	HAPLESS 13, Clathrin adaptor c...		Lus10000107 [exp]	175.8
					Lus10000109 [exp]	177.5
AT3G07565			Protein of unknown function (D...		Lus10000123 [exp]	188.5
					Lus10000134 [exp]	196.8

Compare expression of checked genes

Lus10000290 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.