Lus10000292 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001993 160 / 2e-51 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10000292 pacid=23173080 polypeptide=Lus10000292 locus=Lus10000292.g ID=Lus10000292.BGIv1.0 annot-version=v1.0
ATGAAACCACCCCCAACTTCTTCTTTTTCTTCATCTTCTTCTTCCATGCTTACTAGTCCAGTATCTATCAAAAGATTTCTTCCCTGCTCTACCATCAAGA
GATACAACAGCGGAGAGAGGAAAGACGAGAATAAGAAAGAAGAAGAAGAAGAAGAAAACGTAATAGCAGGAGATCATGTCAGGGCGCCATCTCTGGCAGA
TGAGTTTAGGAGACTGGAGGGGGAGAAATCCAAGGAAGAAGATAATCTCCATGACATTGTTGATAGTGGAATAGCGAGTCAGACGGTGGGGAAAACAATG
GACGGATTAGATGAGGCATTGGATAAGGAGGCCGACCTGGAATCGGTGAAGAATAGGTACAAGGAGCACGAACCGGGTGCTGATTATCGCCGGAGAGGGA
CCAATACTACTAGTTACTAG
AA sequence
>Lus10000292 pacid=23173080 polypeptide=Lus10000292 locus=Lus10000292.g ID=Lus10000292.BGIv1.0 annot-version=v1.0
MKPPPTSSFSSSSSSMLTSPVSIKRFLPCSTIKRYNSGERKDENKKEEEEEENVIAGDHVRAPSLADEFRRLEGEKSKEEDNLHDIVDSGIASQTVGKTM
DGLDEALDKEADLESVKNRYKEHEPGADYRRRGTNTTSY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10000292 0 1
Lus10021979 2.8 0.6808
AT4G09160 SEC14 cytosolic factor family ... Lus10025540 5.2 0.5965
AT3G56230 BTB/POZ domain-containing prot... Lus10017414 9.8 0.6182
Lus10018645 21.0 0.6182
AT5G01740 Nuclear transport factor 2 (NT... Lus10022755 21.7 0.6026
Lus10032733 36.3 0.5465
AT2G16910 bHLH AMS, bHLH021 ABORTED MICROSPORES, basic hel... Lus10042395 54.5 0.5446
AT1G14920 GRAS RGA2, GAI RESTORATION ON GROWTH ON AMMON... Lus10036458 73.4 0.4930
Lus10029069 80.3 0.5582
AT5G48450 SKS3 SKU5 similar 3 (.1) Lus10040424 82.0 0.5404

Lus10000292 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.