Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G17960 75 / 2e-18 unknown protein AT5G46620 57 / 1e-11 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030960 [exp] 97 / 4e-27 AT4G17960 144 / 2e-44 unknown protein Lus10040087 [exp] 90 / 3e-24 AT4G17960 134 / 1e-40 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G143600 [exp] 93 / 2e-25 AT4G17960 164 / 1e-52 unknown protein Potri.003G090600 [exp] 85 / 2e-22 AT4G17960 151 / 2e-47 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000314 pacid=23177778 polypeptide=Lus10000314 locus=Lus10000314.g ID=Lus10000314.BGIv1.0 annot-version=v1.0 ATGGATTGTGGTGTTAACTCAATGGATTTTGTATTGATTTCTAGTTTGACAGAAATTCTGCAGCTGGGACTCCGATGGTACGCGAGGCTCCTCAAGGTAG ACGAAGATGGAGACGTGGCAGATGAGTTCCTGGACGAGACAGTATCATCAGATAGGTTCGAAAGCAAATCAAGTACCCGTCGTGCCAAGGTCAAGAGGCA GATCATTTCTCGCGATGGGAAATTCCAACACTGTGTCGAGTATCAAGGTAGATTGCTGTGGATATGA
AA sequence Show only first row Show all	>Lus10000314 pacid=23177778 polypeptide=Lus10000314 locus=Lus10000314.g ID=Lus10000314.BGIv1.0 annot-version=v1.0 MDCGVNSMDFVLISSLTEILQLGLRWYARLLKVDEDGDVADEFLDETVSSDRFESKSSTRRAKVKRQIISRDGKFQHCVEYQGRLLWI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G17960			unknown protein		Lus10000314 [exp]	0	1
AT4G22310			Uncharacterised protein family...		Lus10023745 [exp]	1.4	0.9666
AT3G22290			Endoplasmic reticulum vesicle ...		Lus10023828 [exp]	2.0	0.9603
AT1G11905			B-cell receptor-associated pro...		Lus10000048 [exp]	2.0	0.9576
AT2G28430			unknown protein		Lus10021477 [exp]	3.7	0.9366
AT1G56700			Peptidase C15, pyroglutamyl pe...		Lus10001521 [exp]	4.2	0.9537
AT5G03455		ACR2, ARATH;CDC...	ARSENATE REDUCTASE 2, Rhodanes...		Lus10022616 [exp]	5.9	0.9544
AT5G49710			unknown protein		Lus10000765 [exp]	6.9	0.9585
					Lus10006539 [exp]	7.2	0.9386
AT4G33690			unknown protein		Lus10040497 [exp]	8.5	0.9348
AT1G55160			unknown protein		Lus10019322 [exp]	10.4	0.9320

Compare expression of checked genes

Lus10000314 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.