Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000977 [exp] 88 / 2e-21 ND / Lus10034058 [exp] 82 / 2e-21 ND / Lus10042579 [exp] 81 / 7e-21 ND / Lus10024464 [exp] 82 / 1e-20 ND / Lus10024465 [exp] 81 / 1e-20 ND / Lus10012087 [exp] 83 / 3e-20 AT1G17930 57 / 4e-09 Aminotransferase-like, plant mobile domain family protein (.1) Lus10003272 [exp] 81 / 5e-20 ND 39 / 0.002 Lus10032803 [exp] 81 / 2e-19 ND / Lus10000302 [exp] 78 / 2e-19 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000325 pacid=23149751 polypeptide=Lus10000325 locus=Lus10000325.g ID=Lus10000325.BGIv1.0 annot-version=v1.0 ATGCTCCTAAAGGCCGACCGCGTGCAAGAAAGACCGACCGTCGAAATCCTTCTTGGCATGAGCATGCTAGTGCACAGTGTACTCCTCCGAAAAGCAGAGG TAGCTCGACTAGATCTACACCTTCCTCGAAGGGTACTACTTCGAACACTGGCGCAAGACCGCGCTAAACAGATGTGGGAACATGACTTATACCGTGATGA CCATGCAGAGTATGAACGATTGAATCCGTGGAATCGAACTTACAAGCTCATATGGGACTCCCACACCGGGGTTAGCCGGCGCCACGATGCGCAGGTGACT GTGCTCGAGATACCGGTCCATGTACCTTGGACCAAAATCCGCACCGGACACTGCCCTCTCGAACATAAGGTGTAG
AA sequence Show only first row Show all	>Lus10000325 pacid=23149751 polypeptide=Lus10000325 locus=Lus10000325.g ID=Lus10000325.BGIv1.0 annot-version=v1.0 MLLKADRVQERPTVEILLGMSMLVHSVLLRKAEVARLDLHLPRRVLLRTLAQDRAKQMWEHDLYRDDHAEYERLNPWNRTYKLIWDSHTGVSRRHDAQVT VLEIPVHVPWTKIRTGHCPLEHKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10000325 [exp]	0	1
					Lus10002099 [exp]	1.0	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10005495 [exp]	1.4	1.0000
					Lus10011594 [exp]	1.7	1.0000
AT4G17920			RING/U-box superfamily protein...		Lus10030972 [exp]	2.0	1.0000
AT2G42850		CYP718	"cytochrome P450, family 718",...		Lus10031391 [exp]	2.2	1.0000
AT1G61290		ATSYP124, SYP12...	syntaxin of plants 124 (.1)		Lus10006735 [exp]	2.4	1.0000
AT1G52540			Protein kinase superfamily pro...		Lus10006985 [exp]	2.6	1.0000
AT5G18880			RNA-directed DNA polymerase (r...		Lus10018808 [exp]	2.8	1.0000
					Lus10037814 [exp]	3.0	1.0000
AT2G36870		XTH32	xyloglucan endotransglucosylas...		Lus10026536 [exp]	6.3	0.9660

Compare expression of checked genes

Lus10000325 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.