Lus10000327 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06450 174 / 1e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G61470 164 / 1e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 159 / 2e-46 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44240 157 / 2e-46 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT2G32070 156 / 1e-45 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G15920 154 / 1e-44 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
AT1G80780 153 / 2e-44 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT5G10960 152 / 6e-44 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27890 152 / 7e-44 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44260 138 / 7e-39 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035078 577 / 0 AT1G06450 168 / 2e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017905 436 / 2e-154 AT1G06450 162 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10001651 429 / 1e-150 AT1G61470 167 / 4e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10008043 424 / 7e-150 AT1G06450 165 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035077 411 / 7e-145 AT1G61470 162 / 6e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10000561 395 / 1e-138 AT1G61470 143 / 1e-40 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10038113 324 / 7e-112 AT3G44240 140 / 3e-41 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10007771 250 / 1e-81 AT1G61470 170 / 5e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10029713 238 / 4e-77 AT5G10960 144 / 4e-41 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G038700 229 / 1e-73 AT1G61470 182 / 8e-56 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G046700 159 / 1e-46 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 158 / 2e-46 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.018G020900 149 / 7e-43 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G205600 149 / 1e-42 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G073000 148 / 1e-42 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G262500 145 / 2e-41 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.009G161500 144 / 3e-41 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G187200 144 / 4e-41 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.004G200400 140 / 1e-39 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF04857 CAF1 CAF1 family ribonuclease
Representative CDS sequence
>Lus10000327 pacid=23149795 polypeptide=Lus10000327 locus=Lus10000327.g ID=Lus10000327.BGIv1.0 annot-version=v1.0
ATGGGTTTTCTCGTGAGGGAAGTCTGGGACGAAAATCTCCGTCAAGAATTGAAAGCCATGGAAGAATGTCTGGCCAAGTACCCAGTTATATCAGTCGACT
CCGAATTCCCAGGCTTCCTCCGTCAAACGCCGAGATACGCTTCCGAGGAGCTCCGATTTGAGAACTTGAAGTACAACGTCGGCCAAACCTCTCTCGTTCA
ATTAGGGCTCACTCTCTCAAACACAAAAGGCACCGTCGGCGGAATCTGGCAATTCAACTTCCAATTCGATCTAGACAGCGATCTCCACTGCCCAAATTCG
ATCCAATTTTTAATCCTCCACGGCATCGATTTCAACAAGCTCAAAACCTACGGGATTGACCGGGTCAAATTTGGCACGGTGTTCGGAAGGCTGATTGCGA
GAAGGAAGAGTTCGATTACGTGGATTACTTTCCACGGCGTGTACGACCTCGCCCATATTGTGAAGGCGGTGAGTTTCCGTCCGGTTGCGGAATCGTCGGC
GGAATTCGTTGACGTTTTGGGGAGGGGGTTTGACTCGGTTGTTGATGTGAAATACATGGCTAAGTTTTATCAAGGGACAGGGAGTGAAATTGGATTGCAG
AAGTTGGCTGATAATTTAGGGGTTAAGAGAAGAGGGGAAGCTCATACGGCTGCTTCCGACAGTTTGTTGACGGCGCTGGTTTACTTCAAGCTGAAGAAGA
AGCTGAAGCAGCAGGGGATTGAGGAAAACGTTTACTTTGACTTGGTGTATGGAATTAGTTCCAGAATCTCTAGGGAGTTCATCAATGCTACTGCTGCTGC
TGCTGCTCTTGTGTATCAGGGGGATATGGTGTATGCGAATCCGTATTACAAGAGGAATTTGGCTGCCGAATTGATGATGATGGGTCATTGGGATTATTGC
TCCTCCACTACTGGTGCAACACCAGTGTCATCTCTGATCTACGGATGA
AA sequence
>Lus10000327 pacid=23149795 polypeptide=Lus10000327 locus=Lus10000327.g ID=Lus10000327.BGIv1.0 annot-version=v1.0
MGFLVREVWDENLRQELKAMEECLAKYPVISVDSEFPGFLRQTPRYASEELRFENLKYNVGQTSLVQLGLTLSNTKGTVGGIWQFNFQFDLDSDLHCPNS
IQFLILHGIDFNKLKTYGIDRVKFGTVFGRLIARRKSSITWITFHGVYDLAHIVKAVSFRPVAESSAEFVDVLGRGFDSVVDVKYMAKFYQGTGSEIGLQ
KLADNLGVKRRGEAHTAASDSLLTALVYFKLKKKLKQQGIEENVYFDLVYGISSRISREFINATAAAAALVYQGDMVYANPYYKRNLAAELMMMGHWDYC
SSTTGATPVSSLIYG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06450 Polynucleotidyl transferase, r... Lus10000327 0 1
AT1G06450 Polynucleotidyl transferase, r... Lus10035078 1.0 0.9803
AT4G34320 Protein of unknown function (D... Lus10011295 1.4 0.9688
AT1G64700 unknown protein Lus10008274 3.5 0.9642
AT5G22250 AtCAF1b CCR4- associated factor 1b, Po... Lus10034180 3.5 0.9631
AT5G47390 MYB myb-like transcription factor ... Lus10040181 3.6 0.9336
AT4G34320 Protein of unknown function (D... Lus10040489 5.5 0.9423
AT4G11070 WRKY ATWRKY41, WRKY4... WRKY family transcription fact... Lus10023099 6.7 0.9443
AT1G07160 Protein phosphatase 2C family ... Lus10026381 6.7 0.9384
AT5G38700 unknown protein Lus10001456 7.0 0.9418
AT5G18150 Methyltransferase-related prot... Lus10034423 7.7 0.9340

Lus10000327 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.