Lus10000337 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64650 309 / 2e-105 Major facilitator superfamily protein (.1.2)
AT4G27720 303 / 3e-103 Major facilitator superfamily protein (.1)
AT3G49310 291 / 1e-98 Major facilitator superfamily protein (.1)
AT2G23093 40 / 0.0005 Major facilitator superfamily protein (.1)
AT5G17010 39 / 0.0008 Major facilitator superfamily protein (.1.2.3.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033228 329 / 4e-113 AT1G64650 835 / 0.0 Major facilitator superfamily protein (.1.2)
Lus10003219 295 / 5e-100 AT1G64650 821 / 0.0 Major facilitator superfamily protein (.1.2)
Lus10017322 297 / 9e-100 AT1G64650 799 / 0.0 Major facilitator superfamily protein (.1.2)
Lus10011083 52 / 3e-08 AT2G23093 502 / 1e-176 Major facilitator superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G145600 314 / 2e-107 AT1G64650 831 / 0.0 Major facilitator superfamily protein (.1.2)
Potri.015G008100 303 / 3e-103 AT4G27720 827 / 0.0 Major facilitator superfamily protein (.1)
Potri.012G020500 301 / 3e-102 AT4G27720 761 / 0.0 Major facilitator superfamily protein (.1)
Potri.007G052700 45 / 1e-05 AT2G23093 425 / 3e-146 Major facilitator superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0015 MFS PF05631 MFS_5 Sugar-tranasporters, 12 TM
Representative CDS sequence
>Lus10000337 pacid=23163525 polypeptide=Lus10000337 locus=Lus10000337.g ID=Lus10000337.BGIv1.0 annot-version=v1.0
ATGCTCTTCGGGACGATTGTTGGTTCTCTTGCTGACAAACAGGGCCGTAAGCGGGCGTCTATAACTTACTGCATAACTTACATCTTGAGTTGCATCACCA
AGCATTCTCCTCAGTACAAGGTTTTGATGCTTGGACGGGTGCTGGGAGGCATCGCTACTTCTCTGCTGTTTTCGGCATTCGAGTCTTGGCTAGTCGCGGA
ACACTTTAAGAGAGGTTTTGATCAACAGTGGCTCTCGGTAACATTCTCAAAGGCCATATTTCTCGGCAATGGCTTAGTAGCTATTGTTGCTGGATTGTTT
GGAAATGTACTAGTCGATACCCTGGCACTTGGGCCTGTTGCTCCTTTTGATGCTGCTGCATGCTTTCTTGCAATTGGTATGGCAATCATTATCTCTACCT
GGCCAGAAAATTATGGAGATCCTTCAGAAAACAAGGATTTGCTTACTCAATTCAAGGGAGCGGCTGTTGCCATTGCTTCTGGTGAGACCCTAATCTAG
AA sequence
>Lus10000337 pacid=23163525 polypeptide=Lus10000337 locus=Lus10000337.g ID=Lus10000337.BGIv1.0 annot-version=v1.0
MLFGTIVGSLADKQGRKRASITYCITYILSCITKHSPQYKVLMLGRVLGGIATSLLFSAFESWLVAEHFKRGFDQQWLSVTFSKAIFLGNGLVAIVAGLF
GNVLVDTLALGPVAPFDAAACFLAIGMAIIISTWPENYGDPSENKDLLTQFKGAAVAIASGETLI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G64650 Major facilitator superfamily ... Lus10000337 0 1
AT5G54390 ATAHL, AHL HAL2-like (.1) Lus10037888 1.4 0.9527
AT1G19835 Plant protein of unknown funct... Lus10024325 1.4 0.9571
AT1G19835 Plant protein of unknown funct... Lus10024324 3.5 0.9492
AT1G22610 C2 calcium/lipid-binding plant... Lus10009460 3.6 0.9230
AT5G16300 Vps51/Vps67 family (components... Lus10037382 4.6 0.9307
AT2G01970 Endomembrane protein 70 protei... Lus10031876 6.0 0.9409
AT1G13860 QUL1 QUASIMODO2 LIKE 1 (.1.2.3.4) Lus10036883 6.3 0.9364
AT2G01970 Endomembrane protein 70 protei... Lus10031308 6.9 0.9356
AT4G34450 coatomer gamma-2 subunit, puta... Lus10042326 7.3 0.9281
AT5G16720 Protein of unknown function, D... Lus10004050 7.5 0.9058

Lus10000337 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.