Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51660 96 / 2e-27 Tautomerase/MIF superfamily protein (.1) AT5G01650 80 / 3e-21 Tautomerase/MIF superfamily protein (.1.2) AT5G57170 67 / 7e-16 Tautomerase/MIF superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012222 [exp] 146 / 2e-47 AT3G51660 158 / 1e-51 Tautomerase/MIF superfamily protein (.1) Lus10022681 [exp] 72 / 7e-18 AT5G01650 172 / 8e-57 Tautomerase/MIF superfamily protein (.1.2) Lus10014233 [exp] 71 / 1e-17 AT5G01650 169 / 1e-55 Tautomerase/MIF superfamily protein (.1.2) Lus10012223 [exp] 62 / 3e-14 AT5G01650 146 / 9e-47 Tautomerase/MIF superfamily protein (.1.2) Lus10034783 [exp] 62 / 1e-13 AT5G57170 116 / 4e-34 Tautomerase/MIF superfamily protein (.1.2) Lus10033324 [exp] 61 / 4e-13 AT5G57170 119 / 1e-35 Tautomerase/MIF superfamily protein (.1.2) Lus10000345 [exp] 42 / 7e-06 AT5G01650 52 / 2e-11 Tautomerase/MIF superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G104800 [exp] 100 / 3e-29 AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1) Potri.016G127300 [exp] 99 / 1e-28 AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1) Potri.006G104500 [exp] 81 / 9e-22 AT5G01650 200 / 5e-68 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126600 [exp] 81 / 2e-21 AT5G01650 216 / 2e-74 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126500 [exp] 79 / 5e-21 AT5G01650 193 / 2e-65 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126800 [exp] 73 / 2e-18 AT5G01650 185 / 4e-62 Tautomerase/MIF superfamily protein (.1.2) Potri.006G075100 [exp] 72 / 4e-18 AT5G57170 194 / 7e-66 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126700 [exp] 72 / 6e-18 AT5G01650 164 / 6e-54 Tautomerase/MIF superfamily protein (.1.2) Potri.006G104600 [exp] 70 / 4e-17 AT5G01650 180 / 3e-60 Tautomerase/MIF superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0082 [flax] [poplar] MIF PF01187 [flax] [poplar] MIF Macrophage migration inhibitory factor (MIF)
Representative CDS sequence Show only first row Show all	>Lus10000344 pacid=23142321 polypeptide=Lus10000344 locus=Lus10000344.g ID=Lus10000344.BGIv1.0 annot-version=v1.0 ATGGTGGTGTTGAAAGGATCGGTGGCGATAAGGTTCAACGGGACCAAGGAGCCGGCGGCTTACGCCGAGATAGTGGCCGTCGGCGGCATCACCAGAGAGA TCAAGAGGAAGCTAATTGCCACACTGGGTGATGTTCTTCAGAATAGGCTCTCTATTCCCAAGACTCGATTCATTCTCAAAGTATTTGACACCACAACTGT TCCCCTCCCCATTACTTCCAAATTGTAA
AA sequence Show only first row Show all	>Lus10000344 pacid=23142321 polypeptide=Lus10000344 locus=Lus10000344.g ID=Lus10000344.BGIv1.0 annot-version=v1.0 MVVLKGSVAIRFNGTKEPAAYAEIVAVGGITREIKRKLIATLGDVLQNRLSIPKTRFILKVFDTTTVPLPITSKL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51660			Tautomerase/MIF superfamily pr...		Lus10000344 [exp]	0	1
AT3G62150		ABCB21, PGP21	ATP-binding cassette B21, P-gl...		Lus10000052 [exp]	5.2	0.9527
AT5G15130	WRKY	ATWRKY72, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10024246 [exp]	5.7	0.9458
AT2G38310		RCAR10, PYL4	regulatory components of ABA r...		Lus10007530 [exp]	9.0	0.9412
AT4G30600			signal recognition particle re...		Lus10035066 [exp]	9.5	0.9474
AT1G70570			anthranilate phosphoribosyltra...		Lus10006201 [exp]	10.1	0.9265
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10038983 [exp]	10.8	0.9519
AT4G08850			Leucine-rich repeat receptor-l...		Lus10008712 [exp]	11.2	0.9331
AT3G57530		ATCPK32, CDPK32...	calcium-dependent protein kina...		Lus10026742 [exp]	12.0	0.9428
AT4G05390		ATRFNR1	root FNR 1 (.1.2)		Lus10023266 [exp]	13.6	0.9446
AT3G63010		ATGID1B, GID1B	GA INSENSITIVE DWARF1B, alpha/...		Lus10008189 [exp]	13.7	0.9420

Compare expression of checked genes

Lus10000344 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.