Lus10000350 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10000350 pacid=23180905 polypeptide=Lus10000350 locus=Lus10000350.g ID=Lus10000350.BGIv1.0 annot-version=v1.0
ATGGAGGAGATACAAAAGGCTAAAAGAACTGAGGCTTCCTTCTTTGCGCTTTATCAGTCATGGATATTGATTAGGTGGTGCCGCTGCTTTTCCTCTATTG
GCGGCTTGACCCTTCCTCCTCCGGATCGCCATGAAGTTACAGTCGTTGTGAACACCGATCCTTTTGCTTCGTTACCATCGCTGCCGCCGGGCCATGCCCG
CGTCGGCTGGCCATTTGGCCCTGGGATTCTCCCCGCTTGCCCTCAAGAAGCTGGATGGTTTGCTCGACCGGCTTTTAGGCTCTTAGTACTTGTTTCATCT
TCCACTCATTGA
AA sequence
>Lus10000350 pacid=23180905 polypeptide=Lus10000350 locus=Lus10000350.g ID=Lus10000350.BGIv1.0 annot-version=v1.0
MEEIQKAKRTEASFFALYQSWILIRWCRCFSSIGGLTLPPPDRHEVTVVVNTDPFASLPSLPPGHARVGWPFGPGILPACPQEAGWFARPAFRLLVLVSS
STH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10000350 0 1
AT2G01570 GRAS RGA1 REPRESSOR OF GA1-3 1, REPRESSO... Lus10014786 3.5 0.5910
Lus10003030 20.0 0.6380
AT1G72470 ATEXO70D1 exocyst subunit exo70 family p... Lus10001112 22.8 0.4915
AT5G61000 ATRPA70D Replication factor-A protein 1... Lus10003025 33.8 0.5830
AT4G12080 AT-hook ATAHL1, AHL1 AT-hook motif nuclear-localize... Lus10000381 44.7 0.5504
AT2G30460 Nucleotide/sugar transporter f... Lus10008596 63.5 0.4673
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10027947 67.7 0.4948
AT1G58370 ATXYN1, RXF12 ARABIDOPSIS THALIANA XYLANASE ... Lus10020790 83.1 0.5011
AT3G14880 unknown protein Lus10013746 102.5 0.4946
AT3G23280 XBAT35 XB3 ortholog 5 in Arabidopsis ... Lus10003551 125.6 0.4796

Lus10000350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.