Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011706 [exp] 87 / 1e-22 ND / Lus10007226 [exp] 60 / 7e-12 ND / Lus10029230 [exp] 56 / 8e-11 ND / Lus10011077 [exp] 48 / 4e-08 ND / Lus10018790 [exp] 48 / 7e-08 ND / Lus10002796 [exp] 46 / 8e-08 ND / Lus10038591 [exp] 44 / 3e-06 ND / Lus10006124 [exp] 42 / 2e-05 AT3G22520 340 / 4e-106 unknown protein Lus10013515 [exp] 41 / 2e-05 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000351 pacid=23180906 polypeptide=Lus10000351 locus=Lus10000351.g ID=Lus10000351.BGIv1.0 annot-version=v1.0 ATGACTGATGCGCCTATTTACGGAAATGTACGACGTTTGGGGATGAGCGAGAGCGAAAACGGACGGATTTGGAGTGACTGGAGAGGAACACGGCATGTTC CAACCGGAAAACGACGTGTTCCGGTTATGAAATTGGGCGAAAACTTACAGGGGACGAACACGGCCAGGAACACGGCGTGTTCCGGTTATGAAAATCGGGC GAAAACTTACAGGGGAGGAATACGGCAAGGTACACGGCGTGTGGCAGGGCTTGTTCTGAAGAACACGCCGTGTTCCATATAG
AA sequence Show only first row Show all	>Lus10000351 pacid=23180906 polypeptide=Lus10000351 locus=Lus10000351.g ID=Lus10000351.BGIv1.0 annot-version=v1.0 MTDAPIYGNVRRLGMSESENGRIWSDWRGTRHVPTGKRRVPVMKLGENLQGTNTARNTACSGYENRAKTYRGGIRQGTRRVAGLVLKNTPCSI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10000351 [exp]	0	1
					Lus10002886 [exp]	1.0	1.0000
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10021543 [exp]	1.4	1.0000
					Lus10014748 [exp]	1.7	1.0000
AT3G26880			Plant self-incompatibility pro...		Lus10022631 [exp]	2.0	1.0000
AT3G25050		XTH3	xyloglucan endotransglucosylas...		Lus10022782 [exp]	2.2	1.0000
					Lus10023108 [exp]	2.4	1.0000
AT5G50790		SWEET10, AtSWEE...	Nodulin MtN3 family protein (....		Lus10023249 [exp]	2.6	1.0000
					Lus10024321 [exp]	2.8	1.0000
AT2G02850		ARPN	plantacyanin (.1)		Lus10028396 [exp]	3.0	1.0000
AT2G46530	ARF	ARF11	auxin response factor 11 (.1.2...		Lus10030240 [exp]	3.2	1.0000

Compare expression of checked genes

Lus10000351 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.