Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G56580 68 / 2e-16 SVB SMALLER WITH VARIABLE BRANCHES, Protein of unknown function, DUF538 (.1) AT1G09310 62 / 5e-14 Protein of unknown function, DUF538 (.1) AT5G46230 44 / 3e-07 Protein of unknown function, DUF538 (.1) AT5G49600 42 / 2e-06 Protein of unknown function, DUF538 (.1) AT4G24130 39 / 4e-05 Protein of unknown function, DUF538 (.1) AT1G30020 37 / 0.0001 Protein of unknown function, DUF538 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039866 [exp] 86 / 7e-23 AT1G09310 196 / 5e-64 Protein of unknown function, DUF538 (.1) Lus10031428 [exp] 84 / 1e-22 AT1G09310 185 / 2e-60 Protein of unknown function, DUF538 (.1) Lus10010904 [exp] 84 / 1e-22 AT1G09310 185 / 1e-60 Protein of unknown function, DUF538 (.1) Lus10018630 [exp] 85 / 2e-22 AT1G09310 195 / 5e-64 Protein of unknown function, DUF538 (.1) Lus10017087 [exp] 41 / 9e-06 AT5G49600 145 / 3e-43 Protein of unknown function, DUF538 (.1) Lus10037804 [exp] 40 / 1e-05 AT5G49600 144 / 2e-44 Protein of unknown function, DUF538 (.1) Lus10017330 [exp] 37 / 0.0001 AT4G24130 209 / 3e-70 Protein of unknown function, DUF538 (.1) Lus10001674 [exp] 37 / 0.0001 AT4G24130 212 / 2e-71 Protein of unknown function, DUF538 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G007000 [exp] 70 / 4e-17 AT1G56580 176 / 5e-57 SMALLER WITH VARIABLE BRANCHES, Protein of unknown function, DUF538 (.1) Potri.005G011200 [exp] 68 / 3e-16 AT1G56580 192 / 4e-63 SMALLER WITH VARIABLE BRANCHES, Protein of unknown function, DUF538 (.1) Potri.004G064700 [exp] 49 / 5e-09 AT5G46230 184 / 4e-61 Protein of unknown function, DUF538 (.1) Potri.010G149100 [exp] 44 / 7e-07 AT5G49600 152 / 3e-47 Protein of unknown function, DUF538 (.1) Potri.001G084200 [exp] 40 / 2e-05 AT4G24130 208 / 5e-70 Protein of unknown function, DUF538 (.1) Potri.003G146400 [exp] 39 / 2e-05 AT4G24130 211 / 5e-71 Protein of unknown function, DUF538 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000354 pacid=23175439 polypeptide=Lus10000354 locus=Lus10000354.g ID=Lus10000354.BGIv1.0 annot-version=v1.0 ATGTCCCTGGTCACCGAAGAGATCAAGGCCACTGCTTCTGAGCTGCACAGTGGCGATGAGATCTGCCAGCAGAAATCCAAGGAGCTGCTCAAGGAGATGC AACTTCCCAATGGGCTGCTGCCACTGCACAATATAGAGGAGTTTGGAATTGTGAGGGAGCGGGATTTGTGTGGCTGA
AA sequence Show only first row Show all	>Lus10000354 pacid=23175439 polypeptide=Lus10000354 locus=Lus10000354.g ID=Lus10000354.BGIv1.0 annot-version=v1.0 MSLVTEEIKATASELHSGDEICQQKSKELLKEMQLPNGLLPLHNIEEFGIVRERDLCG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G56580		SVB	SMALLER WITH VARIABLE BRANCHES...		Lus10000354 [exp]	0	1
AT4G38960	CO		B-box type zinc finger family ...		Lus10035472 [exp]	6.5	0.8541
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Lus10018525 [exp]	7.2	0.8658
AT5G18670		BAM9, BMY3	BETA-AMYLASE 9, beta-amylase 3...		Lus10012804 [exp]	9.6	0.8733
AT4G31830			unknown protein		Lus10010682 [exp]	15.4	0.8751
AT4G33820			Glycosyl hydrolase superfamily...		Lus10014647 [exp]	16.6	0.7984
AT1G21890			nodulin MtN21 /EamA-like trans...		Lus10021201 [exp]	28.9	0.8529
					Lus10009436 [exp]	29.9	0.8403
AT3G05640			Protein phosphatase 2C family ...		Lus10037709 [exp]	33.6	0.8644
AT1G54540			Late embryogenesis abundant (L...		Lus10031888 [exp]	36.2	0.8454
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Lus10039743 [exp]	36.6	0.8426

Compare expression of checked genes

Lus10000354 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.