Lus10000357 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14520 178 / 9e-54 pescadillo-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001362 240 / 2e-82 AT5G14520 164 / 3e-48 pescadillo-related (.1)
Lus10000618 250 / 4e-81 AT5G14520 787 / 0.0 pescadillo-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G121400 179 / 4e-54 AT5G14520 799 / 0.0 pescadillo-related (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06732 Pescadillo_N Pescadillo N-terminus
Representative CDS sequence
>Lus10000357 pacid=23175443 polypeptide=Lus10000357 locus=Lus10000357.g ID=Lus10000357.BGIv1.0 annot-version=v1.0
ATGACGAAGACGGACATCGCGAAGAAGACATCGGCCAAGCTGAAGAAGAACAAACACTACAGACCTTCTGGGAAGAAGAAGGAAGGGAACGCTGCCCGGT
ACATGACCCGGTCGCAGGCTATCAAGCAGCTCCAAGTTAATCTCAACGTCTTCAGGCAGCTCTGCATTCTCAAAGGTGTGTTCCCTAGAGAACCGAAGAA
GAAGGTTAGAGGGAATAACCAGACGTACTACCATGTCAAGGATATAAATTTCATCCAACATGAACCCTTACTTGAGAAGTTGAGGGAAAAGAGGGCATAC
GAAAGGAAAATACAGAAGGCTTTGGCTAAGAAGAACGAAGATCTAGCAACTCGTCTTCGAACTCGAGAGCCAACTTACACATTGGACAAGCTCATTCTGG
AAAGGTTTATTAAGCCCATTGATTTATTAGATTCCCTTTGA
AA sequence
>Lus10000357 pacid=23175443 polypeptide=Lus10000357 locus=Lus10000357.g ID=Lus10000357.BGIv1.0 annot-version=v1.0
MTKTDIAKKTSAKLKKNKHYRPSGKKKEGNAARYMTRSQAIKQLQVNLNVFRQLCILKGVFPREPKKKVRGNNQTYYHVKDINFIQHEPLLEKLREKRAY
ERKIQKALAKKNEDLATRLRTREPTYTLDKLILERFIKPIDLLDSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14520 pescadillo-related (.1) Lus10000357 0 1
AT4G34910 P-loop containing nucleoside t... Lus10015433 2.2 0.9452
AT1G61010 CPSF73-I cleavage and polyadenylation s... Lus10001371 2.2 0.9260
AT1G09620 ATP binding;leucine-tRNA ligas... Lus10032320 3.0 0.9200
AT1G80410 OMA, EMB2753 OMISHA, EMBRYO DEFECTIVE 2753,... Lus10011474 5.3 0.9364
AT1G80410 OMA, EMB2753 OMISHA, EMBRYO DEFECTIVE 2753,... Lus10023111 6.0 0.9355
AT5G51540 Zincin-like metalloproteases f... Lus10031136 6.2 0.8863
AT1G59760 AtMTR4 homolog of yeast MTR4, RNA hel... Lus10024454 7.0 0.9226
AT2G18900 Transducin/WD40 repeat-like su... Lus10003637 10.0 0.9266
AT3G19740 P-loop containing nucleoside t... Lus10040976 11.0 0.9068
AT5G44230 Pentatricopeptide repeat (PPR)... Lus10014279 11.5 0.8373

Lus10000357 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.