Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032337 [exp] 39 / 0.0001 AT3G42170 839 / 0.0 BED zinc finger ;hAT family dimerisation domain (.1) Lus10005558 [exp] 37 / 0.0005 AT3G42170 351 / 5e-111 BED zinc finger ;hAT family dimerisation domain (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G126500 [exp] 42 / 7e-06 AT3G42170 796 / 0.0 BED zinc finger ;hAT family dimerisation domain (.1) Potri.004G126740 [exp] 42 / 1e-05 AT3G42170 803 / 0.0 BED zinc finger ;hAT family dimerisation domain (.1) Potri.001G383800 [exp] 41 / 2e-05 AT3G42170 387 / 4e-125 BED zinc finger ;hAT family dimerisation domain (.1) Potri.003G031700 [exp] 40 / 4e-05 AT3G42170 581 / 0.0 BED zinc finger ;hAT family dimerisation domain (.1) Potri.018G126750 [exp] 39 / 8e-05 AT3G42170 857 / 0.0 BED zinc finger ;hAT family dimerisation domain (.1) Potri.011G104000 [exp] 39 / 9e-05 AT3G42170 381 / 7e-123 BED zinc finger ;hAT family dimerisation domain (.1) Potri.004G126780 [exp] 39 / 0.0001 AT3G42170 796 / 0.0 BED zinc finger ;hAT family dimerisation domain (.1) Potri.011G125951 [exp] 37 / 0.0003 AT3G42170 313 / 2e-95 BED zinc finger ;hAT family dimerisation domain (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000359 pacid=23175810 polypeptide=Lus10000359 locus=Lus10000359.g ID=Lus10000359.BGIv1.0 annot-version=v1.0 ATGAGTGGTCGACTTATGGACTCGTTTAGAAGCTCTTTAGCTCCTAGTACGCTTGAGGCTATAGCATGCGCTGAAGATTGGCTAAGGAGTGCAGACAGTG TTCAAAACAACGAGGAGGACCTCCCGGAGCATGAACAGGAACTAGAATGGGTACCCAATCCCGCCCGGGCAATGGGTACCCGTAGTTTCGAATGGGTTTG GGACATGAGAACCAAATTTCCGATGTTATGGGATGGGTACCCGTAG
AA sequence Show only first row Show all	>Lus10000359 pacid=23175810 polypeptide=Lus10000359 locus=Lus10000359.g ID=Lus10000359.BGIv1.0 annot-version=v1.0 MSGRLMDSFRSSLAPSTLEAIACAEDWLRSADSVQNNEEDLPEHEQELEWVPNPARAMGTRSFEWVWDMRTKFPMLWDGYP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10000359 [exp]	0	1
					Lus10016322 [exp]	2.4	0.8586
AT4G26220			S-adenosyl-L-methionine-depend...		Lus10009484 [exp]	2.4	0.8530
AT2G39530			Uncharacterised protein family...		Lus10031303 [exp]	8.9	0.8668
AT3G02840			ARM repeat superfamily protein...		Lus10021822 [exp]	15.5	0.8018
AT3G60330		AHA7	H\(+\)-ATPase 7, H\(+\)-ATPase...		Lus10042904 [exp]	18.0	0.8609
AT3G55005		TON1B	tonneau 1b (TON1b) (.1)		Lus10023478 [exp]	18.5	0.8485
AT1G16470		PAB1	proteasome subunit PAB1 (.1.2)		Lus10017135 [exp]	23.1	0.8364
AT5G63080			2-oxoglutarate (2OG) and Fe(II...		Lus10001249 [exp]	27.1	0.8559
					Lus10031873 [exp]	29.8	0.8415
AT2G37640		ATHEXPALPHA1.9,...	ARABIDOPSIS THALIANA EXPANSIN ...		Lus10002638 [exp]	30.2	0.8415

Compare expression of checked genes

Lus10000359 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.