Lus10000370 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G59077 63 / 2e-12 unknown protein
AT1G58766 63 / 2e-12 unknown protein
AT1G59453 63 / 2e-12 B-block binding subunit of TFIIIC (.1)
AT1G17450 63 / 3e-12 B-block binding subunit of TFIIIC (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022089 277 / 3e-95 AT1G59077 210 / 1e-62 unknown protein
Lus10015659 133 / 2e-39 AT1G17450 111 / 3e-36 B-block binding subunit of TFIIIC (.1.2)
Lus10037675 138 / 1e-38 AT1G17450 1340 / 0.0 B-block binding subunit of TFIIIC (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G064000 103 / 2e-26 AT1G17450 1446 / 0.0 B-block binding subunit of TFIIIC (.1.2)
PFAM info
Representative CDS sequence
>Lus10000370 pacid=23149346 polypeptide=Lus10000370 locus=Lus10000370.g ID=Lus10000370.BGIv1.0 annot-version=v1.0
ATGGTTGATTCTGTCATTGATGTGCTCCAAACGTTTGGACGAGTATTAAAGGTCAATGCTTATGACTCGGTTCGTGTTGTTGATGCTTTATATCTGACCA
AGTACTCTTTGACCTCGAGGCCTTCTTTGGATAGCGATCCTAAGTCAATGTCAGAGTCATATGAGAGAAGTGAGGATGGTCAACCCGAAACTAATGAATC
AGTTAACCCTAAGCCCCATGCTGCAGCAGACCAATCGATCTCGGGCGACAATGATGTGCACAAAGTTACTATTCTTAACCTTCCAGACGAGGCCGTGCCA
TTGAGAGAAACACAAAGTAGAAACTCACAAGAAAGTGATGTGCAAGACCAGAACGTGATAAATATTCATGAACAACGTATTGATAGTAAAAGTTATATGC
CAATCCTCCCATGA
AA sequence
>Lus10000370 pacid=23149346 polypeptide=Lus10000370 locus=Lus10000370.g ID=Lus10000370.BGIv1.0 annot-version=v1.0
MVDSVIDVLQTFGRVLKVNAYDSVRVVDALYLTKYSLTSRPSLDSDPKSMSESYERSEDGQPETNESVNPKPHAAADQSISGDNDVHKVTILNLPDEAVP
LRETQSRNSQESDVQDQNVINIHEQRIDSKSYMPILP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G59453 B-block binding subunit of TFI... Lus10000370 0 1
AT1G56140 Leucine-rich repeat transmembr... Lus10010927 4.1 0.8431
AT5G58040 FIP1[V], ATFIP1... homolog of yeast FIP1 [V], hom... Lus10040031 6.0 0.8718
AT5G15020 SNL2 SIN3-like 2 (.1.2) Lus10014505 7.9 0.8768
AT1G32420 F-box and associated interacti... Lus10011190 18.6 0.8024
AT5G55060 unknown protein Lus10021546 21.5 0.8593
AT5G49510 PFD3, PDF3 prefoldin 3 (.1.2) Lus10037784 23.3 0.8323
AT2G45500 AAA-type ATPase family protein... Lus10009233 24.9 0.8680
AT2G28085 SAUR-like auxin-responsive pro... Lus10001397 27.5 0.8317
AT3G07020 UGT80A2, SGT UDP-glucosyl transferase 80A2,... Lus10024544 27.7 0.8621
AT5G59140 BTB/POZ domain-containing prot... Lus10040746 28.8 0.8479

Lus10000370 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.