Lus10000375 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G35420 147 / 1e-44 alpha/beta-Hydrolases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016930 214 / 2e-69 AT1G35420 214 / 2e-66 alpha/beta-Hydrolases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G079000 150 / 1e-45 AT1G35420 332 / 4e-114 alpha/beta-Hydrolases superfamily protein (.1.2)
Potri.013G105634 40 / 0.0002 AT1G35420 89 / 2e-20 alpha/beta-Hydrolases superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0028 AB_hydrolase PF01738 DLH Dienelactone hydrolase family
Representative CDS sequence
>Lus10000375 pacid=23157143 polypeptide=Lus10000375 locus=Lus10000375.g ID=Lus10000375.BGIv1.0 annot-version=v1.0
ATGTCGGACGAATTCCTGGCAGCTGGAATCTCCAAGAAGCTGGGGTTGATCGGATTCTGCTACGGCGGTGGCAGAGTAGTAGAAGTTCTGTCCAGAGATC
AGGGCAACCGGTTCGGGATTGGGATCTCATTCTACGGTACTAGAATCGACACAAGCCTTGTTAGGAAGTTAAGTGCCCCAGTCCTGTTTGTTTCAGGGGA
CAGTGACCCTCTTTGCAGCTTGAGTGTACTCAAGGAGATTGAGAACAAAATTGGCGAGGACAGCAATTCGAAAGTGGTTATCTTCGAAGGAAGAGGTCAC
GTGTTCGCACACCGCCCGAGTTCTGCTGAAGAAGATGAAGATGCAGAGGAGGCTTTTGTGATGCTGAGGAGTTGGTTGAATGATGGTTTTGTGGTGGAGA
GTTGA
AA sequence
>Lus10000375 pacid=23157143 polypeptide=Lus10000375 locus=Lus10000375.g ID=Lus10000375.BGIv1.0 annot-version=v1.0
MSDEFLAAGISKKLGLIGFCYGGGRVVEVLSRDQGNRFGIGISFYGTRIDTSLVRKLSAPVLFVSGDSDPLCSLSVLKEIENKIGEDSNSKVVIFEGRGH
VFAHRPSSAEEDEDAEEAFVMLRSWLNDGFVVES

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G35420 alpha/beta-Hydrolases superfam... Lus10000375 0 1
AT3G50120 Plant protein of unknown funct... Lus10009871 2.2 0.8689
AT3G09880 ATB' BETA, ATB'... Protein phosphatase 2A regulat... Lus10022612 4.2 0.8416
AT4G33940 RING/U-box superfamily protein... Lus10012062 5.8 0.8507
AT2G39570 ACR9 ACT domain repeats 9, ACT doma... Lus10004948 7.7 0.8326
AT4G22250 RING/U-box superfamily protein... Lus10035335 9.2 0.8407
Lus10011351 9.6 0.8102
AT3G09770 LOG2 LOSS OF GDU 2, RING/U-box supe... Lus10037412 9.8 0.8482
AT1G34370 C2H2ZnF STOP1 sensitive to proton rhizotoxic... Lus10011495 10.2 0.8370
Lus10008223 12.0 0.8174
AT3G01750 Ankyrin repeat family protein ... Lus10036974 12.2 0.8491

Lus10000375 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.