Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42500 72 / 9e-17 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42510 71 / 2e-16 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G55210 67 / 5e-15 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) AT3G13660 66 / 8e-15 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G65870 66 / 1e-14 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G58170 66 / 3e-14 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49040 63 / 3e-13 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13650 62 / 6e-13 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT2G21110 61 / 2e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G22900 61 / 2e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029312 [exp] 168 / 7e-55 AT3G13660 135 / 1e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10016231 [exp] 149 / 6e-47 AT1G65870 149 / 8e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10018340 [exp] 96 / 8e-26 AT1G58170 129 / 3e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10029306 [exp] 75 / 7e-18 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10026176 [exp] 74 / 2e-17 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10042488 [exp] 72 / 1e-16 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025063 [exp] 70 / 2e-15 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034482 [exp] 69 / 3e-15 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10030483 [exp] 69 / 3e-15 AT1G65870 164 / 1e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G216400 [exp] 78 / 8e-19 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216200 [exp] 74 / 1e-17 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.003G216300 [exp] 74 / 2e-17 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.016G061000 [exp] 74 / 3e-17 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060900 [exp] 71 / 2e-16 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.006G195300 [exp] 70 / 5e-16 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G009100 [exp] 70 / 6e-16 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060801 [exp] 68 / 2e-15 AT1G58170 164 / 5e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.009G131000 [exp] 66 / 2e-14 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060700 [exp] 64 / 2e-13 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [flax] [poplar] AOC_barrel PF03018 [flax] [poplar] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Lus10000376 pacid=23157142 polypeptide=Lus10000376 locus=Lus10000376.g ID=Lus10000376.BGIv1.0 annot-version=v1.0 ATGTATGTTTTGATACTAGACCCGTCATTGACCAAGACCACCTCCCCCAATGTCACCGACGTCCTCTATGTTCGTCCTGCCTTGCCCAACTCCCCTGTTG GCTTCGGGGCCATAAGCGTCTTCGACGACCCCCTCACCGCTGGGCCCAGCCCTGGCTCGTCCTTGCTGGGCATAGCTCAGGGCTCCTACGCATCTGCTTC TCAGCAGGCGTTCGAGATTATGATGGCGATGAACTTGGTGTTTGTGGGTAGTAAGTTCAACGGAAGCAACCTCACCGTGATGGGAAGGAATGAAGTGCCG TTGAAGGTTAGAGAGTTGCCGGTGGTCGGCGGGACATGA
AA sequence Show only first row Show all	>Lus10000376 pacid=23157142 polypeptide=Lus10000376 locus=Lus10000376.g ID=Lus10000376.BGIv1.0 annot-version=v1.0 MYVLILDPSLTKTTSPNVTDVLYVRPALPNSPVGFGAISVFDDPLTAGPSPGSSLLGIAQGSYASASQQAFEIMMAMNLVFVGSKFNGSNLTVMGRNEVP LKVRELPVVGGT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G42510			Disease resistance-responsive ...		Lus10000376 [exp]	0	1
AT3G14770		SWEET2, AtSWEET...	Nodulin MtN3 family protein (....		Lus10002600 [exp]	9.4	0.7745
AT1G03495			HXXXD-type acyl-transferase fa...		Lus10029826 [exp]	10.8	0.8164
AT1G31720			Protein of unknown function (D...		Lus10034746 [exp]	12.5	0.8030
AT1G48820			Terpenoid cyclases/Protein pre...		Lus10008613 [exp]	13.7	0.7818
AT5G13530		KEG	KEEP ON GOING, protein kinases...		Lus10020272 [exp]	16.6	0.7879
AT1G17860			Kunitz family trypsin and prot...		Lus10030354 [exp]	22.3	0.8145
AT5G43190			Galactose oxidase/kelch repeat...		Lus10007740 [exp]	23.9	0.7746
AT1G20510		OPCL1	OPC-8:0 CoA ligase1 (.1.2)		Lus10015815 [exp]	25.0	0.6663
AT2G24610		ATCNGC14	cyclic nucleotide-gated channe...		Lus10020122 [exp]	26.2	0.7779
AT2G15220			Plant basic secretory protein ...		Lus10019804 [exp]	39.8	0.7485

Compare expression of checked genes

Lus10000376 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.