Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G05920 72 / 3e-16 Subtilase family protein (.1) AT5G03620 69 / 3e-15 Subtilisin-like serine endopeptidase family protein (.1) AT3G14240 65 / 7e-14 Subtilase family protein (.1) AT5G45650 65 / 7e-14 subtilase family protein (.1) AT2G04160 64 / 1e-13 AIR3 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) AT1G01900 63 / 4e-13 SBTI1.1, ATSBT1.1 subtilase family protein (.1) AT3G14067 63 / 4e-13 Subtilase family protein (.1) AT1G04110 62 / 1e-12 SDD1 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) AT5G67360 61 / 2e-12 ARA12 Subtilase family protein (.1) AT5G45640 61 / 3e-12 Subtilisin-like serine endopeptidase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002392 [exp] 155 / 1e-45 AT5G67360 530 / 3e-178 Subtilase family protein (.1) Lus10027891 [exp] 142 / 3e-41 AT5G67360 531 / 3e-178 Subtilase family protein (.1) Lus10002398 [exp] 107 / 8e-31 AT5G67360 66 / 3e-20 Subtilase family protein (.1) Lus10002393 [exp] 92 / 4e-23 AT5G67360 450 / 9e-148 Subtilase family protein (.1) Lus10027892 [exp] 81 / 3e-20 AT1G04110 107 / 1e-26 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Lus10018721 [exp] 83 / 4e-20 AT5G67360 531 / 7e-179 Subtilase family protein (.1) Lus10024814 [exp] 83 / 5e-20 AT3G14240 504 / 3e-169 Subtilase family protein (.1) Lus10027895 [exp] 82 / 1e-19 AT2G04160 207 / 5e-59 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Lus10033431 [exp] 77 / 8e-18 AT2G05920 1103 / 0.0 Subtilase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G100500 [exp] 119 / 9e-33 AT4G34980 541 / 0.0 subtilisin-like serine protease 2 (.1) Potri.003G118800 [exp] 83 / 5e-20 AT1G04110 585 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.014G026600 [exp] 81 / 2e-19 AT5G67360 546 / 0.0 Subtilase family protein (.1) Potri.003G118500 [exp] 74 / 6e-17 AT1G04110 557 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.006G141200 [exp] 74 / 6e-17 AT2G05920 1103 / 0.0 Subtilase family protein (.1) Potri.019G006570 [exp] 73 / 1e-16 AT1G04110 568 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.003G118700 [exp] 72 / 2e-16 AT1G04110 585 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.014G171600 [exp] 69 / 3e-15 AT2G04160 986 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.007G045100 [exp] 68 / 5e-15 AT5G67090 727 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.005G145300 [exp] 68 / 6e-15 AT5G67360 932 / 0.0 Subtilase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00082 [flax] [poplar] Peptidase_S8 Subtilase family
Representative CDS sequence Show only first row Show all	>Lus10000378 pacid=23154559 polypeptide=Lus10000378 locus=Lus10000378.g ID=Lus10000378.BGIv1.0 annot-version=v1.0 ATGGCCAGGCTAGCAATGTACAAGGTGTTGTACAGCGACGACGGTATGGACGGCGAGGAGTCCTACGATGCGGCCGCTACTGATGTCCTCGCCGGGATGG ATCAAGCCATCGAGGATGGCGTCAATGTCATGTCTCTGTCGTTGGCGTTCTTCGAGACCGTGCCATTTTTCGAGAACCACATTGCGATTGGAGTTTTCGC TGCAATGAAAAGGGGCATCTTCGTGGCGTGCTCAGCCAGAAACGGTGGCCTCCACGGGTAA
AA sequence Show only first row Show all	>Lus10000378 pacid=23154559 polypeptide=Lus10000378 locus=Lus10000378.g ID=Lus10000378.BGIv1.0 annot-version=v1.0 MARLAMYKVLYSDDGMDGEESYDAAATDVLAGMDQAIEDGVNVMSLSLAFFETVPFFENHIAIGVFAAMKRGIFVACSARNGGLHG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G45650			subtilase family protein (.1)		Lus10000378 [exp]	0	1

Compare expression of checked genes

Lus10000378 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.