Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027891 [exp] 110 / 4e-30 AT5G67360 531 / 3e-178 Subtilase family protein (.1) Lus10027893 [exp] 96 / 3e-28 ND 34 / 0.005 Lus10002393 [exp] 101 / 6e-27 AT5G67360 450 / 9e-148 Subtilase family protein (.1) Lus10002392 [exp] 100 / 2e-26 AT5G67360 530 / 3e-178 Subtilase family protein (.1) Lus10002396 [exp] 85 / 2e-23 ND 34 / 0.006 Lus10018721 [exp] 39 / 8e-05 AT5G67360 531 / 7e-179 Subtilase family protein (.1) Lus10024814 [exp] 39 / 0.0001 AT3G14240 504 / 3e-169 Subtilase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G100500 [exp] 76 / 5e-18 AT4G34980 541 / 0.0 subtilisin-like serine protease 2 (.1) Potri.002G124500 [exp] 37 / 0.0003 AT5G67090 577 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.014G026500 [exp] 36 / 0.0009 AT5G67090 604 / 0.0 Subtilisin-like serine endopeptidase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000380 pacid=23154558 polypeptide=Lus10000380 locus=Lus10000380.g ID=Lus10000380.BGIv1.0 annot-version=v1.0 ATGACGGCTCTTGTGGAGCCTTCAGTTATCAGTTTTGAATGGCAATATAGTACGGCTGCGTTTAACTTGACTGTGGATGTCGTTTTGAGCGGTGGTTTTA GTGGAGGTAAGAGTGATAACATTGGGAACTATGGGTTTTTGAGTTGGGTTGAGGTGAACGCGACGTATGTTGTTAGGAGTCCAATTGTGTCCGCAATGGC ATCTCTTAGGACTTGA
AA sequence Show only first row Show all	>Lus10000380 pacid=23154558 polypeptide=Lus10000380 locus=Lus10000380.g ID=Lus10000380.BGIv1.0 annot-version=v1.0 MTALVEPSVISFEWQYSTAAFNLTVDVVLSGGFSGGKSDNIGNYGFLSWVEVNATYVVRSPIVSAMASLRT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10000380 [exp]	0	1
AT3G53180		NodGS	nodulin/glutamine synthase-lik...		Lus10023904 [exp]	1.4	1.0000
AT4G11530		CRK34	cysteine-rich RLK (RECEPTOR-li...		Lus10022285 [exp]	2.0	1.0000
					Lus10010383 [exp]	3.0	1.0000
AT2G39080		EMB2799	EMBRYO DEFECTIVE 2799, NAD(P)-...		Lus10037911 [exp]	3.5	0.9994
AT2G24280			alpha/beta-Hydrolases superfam...		Lus10024449 [exp]	4.2	0.9856
					Lus10009632 [exp]	4.5	0.9972
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10015092 [exp]	4.6	0.9820
AT5G18190			Protein kinase family protein ...		Lus10043244 [exp]	5.5	0.9482
AT3G06060		TSC10A	TSC10A, NAD(P)-binding Rossman...		Lus10039501 [exp]	5.7	0.9672
AT3G06060		TSC10A	TSC10A, NAD(P)-binding Rossman...		Lus10039502 [exp]	7.3	0.9611

Compare expression of checked genes

Lus10000380 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.