Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G12400 111 / 3e-34 Nucleotide excision repair, TFIIH, subunit TTDA (.1) AT1G62886 91 / 7e-26 Nucleotide excision repair, TFIIH, subunit TTDA (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007001 [exp] 146 / 5e-48 AT1G12400 111 / 3e-34 Nucleotide excision repair, TFIIH, subunit TTDA (.1) Lus10006998 [exp] 144 / 3e-47 AT1G12400 110 / 8e-34 Nucleotide excision repair, TFIIH, subunit TTDA (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G116000 [exp] 119 / 3e-37 AT1G12400 124 / 2e-39 Nucleotide excision repair, TFIIH, subunit TTDA (.1) Potri.009G138800 [exp] 105 / 5e-32 AT1G12400 115 / 5e-36 Nucleotide excision repair, TFIIH, subunit TTDA (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06331 [flax] [poplar] Tfb5 Transcription factor TFIIH complex subunit Tfb5
Representative CDS sequence Show only first row Show all	>Lus10000383 pacid=23159284 polypeptide=Lus10000383 locus=Lus10000383.g ID=Lus10000383.BGIv1.0 annot-version=v1.0 ATGGTGAATGCAACCAAAGGAGTGTTCATTACCTGTGATATACCCATGGCGCAACTCATTATCAACCTTAACGCTTCCCAACCTGCATCACAGAAGTTCA TCATTCATGTTCTGGATAGCACCCATCTCTTCGTGCAGCCCTACGCAATCGATATGATCAAATCCCACATTACAGAGTTCAGAGACCAGATTTCCTATGA GAAGCCTACTTGA
AA sequence Show only first row Show all	>Lus10000383 pacid=23159284 polypeptide=Lus10000383 locus=Lus10000383.g ID=Lus10000383.BGIv1.0 annot-version=v1.0 MVNATKGVFITCDIPMAQLIINLNASQPASQKFIIHVLDSTHLFVQPYAIDMIKSHITEFRDQISYEKPT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G12400			Nucleotide excision repair, TF...		Lus10000383 [exp]	0	1
AT1G55520		ATTBP2, TBP2	A. THALIANA TATA BINDING PROTE...		Lus10020260 [exp]	13.1	0.7514
AT4G14110		FUS7, EMB143, C...	FUSCA 7, EMBRYO DEFECTIVE 143,...		Lus10005729 [exp]	13.3	0.7824
AT4G20330			Transcription initiation facto...		Lus10005100 [exp]	21.8	0.7450
AT1G63250			DEA(D/H)-box RNA helicase fami...		Lus10019121 [exp]	22.9	0.6578
AT5G41010		NRPE12, NRPD12,...	DNA directed RNA polymerase, 7...		Lus10030353 [exp]	29.7	0.7381
					Lus10019733 [exp]	35.3	0.7010
AT5G64680			unknown protein		Lus10011265 [exp]	42.0	0.7519
					Lus10000657 [exp]	48.7	0.6887
AT1G10890			unknown protein		Lus10043141 [exp]	50.1	0.7511
AT4G31720		STG1, TAFII15, ...	TBP-ASSOCIATED FACTOR 10, SALT...		Lus10005077 [exp]	51.3	0.7488

Compare expression of checked genes

Lus10000383 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.